KEGG   Klebsiella pneumoniae subsp. pneumoniae KP5-1: A593_20180Help
Entry
A593_20180        CDS       T03368                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kpk  Klebsiella pneumoniae subsp. pneumoniae KP5-1
Pathway
kpk00020  Citrate cycle (TCA cycle)
kpk00480  Glutathione metabolism
kpk01100  Metabolic pathways
kpk01110  Biosynthesis of secondary metabolites
kpk01120  Microbial metabolism in diverse environments
kpk01130  Biosynthesis of antibiotics
kpk01200  Carbon metabolism
kpk01210  2-Oxocarboxylic acid metabolism
kpk01230  Biosynthesis of amino acids
Module
kpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A593_20180
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A593_20180
Enzymes [BR:kpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A593_20180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AIE02738
LinkDB All DBs
Position
4234694..4235944
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSLTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaaa
ctgaacgtccctcacaatccgattatcccgttcattgaaggcgacggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgaaaaatcgacccaagtctatggccag
gatgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccaccccagtcggcggcggcatccgttctctgaacgtggcgctgcgccag
gagctggacctctacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaagcaccctgaactgaccgatatggttatcttccgtgaaaactctgaagatatctat
gccggtatcgagtggaaagccgactctgctgaagcagacaaagtcatcaaattcctgcgc
gatgagatgggcgtgaagaaaattcgcttcccggaacattgcggtatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggttcgcgccgcgattgaatacgcgatcaccaac
gatcgtgattccctcaccctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagctgatcgacggc
ggcccgtgggtgaaaatcaagaacccgaacaccggtaaagagatcgtggtgaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactacatctctgacgcgctggcggcacaggttggcggtatc
ggtatcgccccgggcgccaacatcggtgacgagtgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggccaggacaaagtgaacccgggctccatcatcctgtccgca
gaaatgatgctgcgccacatgcagtggttcgaagccgcagacctgatcgtcaaaggcatg
gaaggtgctatcgccgccaagaccgtgacctatgactttgaacgtctgatggaaggcgct
aaactgctgaaatgttcagagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system