KEGG   Kocuria palustris: KPaMU14_00665Help
Entry
KPaMU14_00665     CDS       T04045                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpl  Kocuria palustris
Pathway
kpl00250  Alanine, aspartate and glutamate metabolism
kpl00410  beta-Alanine metabolism
kpl00640  Propanoate metabolism
kpl00650  Butanoate metabolism
kpl01100  Metabolic pathways
kpl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPaMU14_00665
   00650 Butanoate metabolism
    KPaMU14_00665
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPaMU14_00665
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPaMU14_00665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpl01007]
    KPaMU14_00665
Enzymes [BR:kpl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPaMU14_00665
Amino acid related enzymes [BR:kpl01007]
 Aminotransferase (transaminase)
  Class III
   KPaMU14_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALB02392
LinkDB All DBs
Position
145753..147033
Genome map
AA seq 426 aa AA seqDB search
MTSLSPVLKQATPVVVDHARGSWIYGTDGREYLDFTTGIGVTSTGHCHPEVVAAAQEQVG
KIIHAQYTTVMHKPLLELTDKLGEVLPEGLDSVFYANSGSEAVEASIRLARMAAGRPNIV
VFQGGFHGRTVAAASLTTAGTKFSAGFAPLMAGVHMSAFPYAYRYGWDEPTAVEFALKEL
DYLLQTRTAPSDTAAFLIEPALGDGGYIPTPPAFLEGLRERADRHGIVLIFDEVQAGVGR
TGKFWGHQHSSARPDVLITAKGIASGFPISAIAASTELMSKAWPGSQGGTYGGNAVSAAA
GVATLGVVEKEGLVENSRVRGEQLQAGLKQIQQRFPVIGDVRGLGLMQGIEFTAPDGSPD
AATAAAVQQATTEQDLLSLTCGPAGNVVRLIPALVVSEEEIALGLQRFEAAVEAVVSSAP
SGTTGA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacatctctgagtcccgtcctcaagcaggccaccccggtggtcgtcgaccacgcccgc
ggcagctggatatacggcaccgacgggcgcgagtacctcgacttcaccaccgggatcggc
gtcacgagcaccgggcactgccacccggaggtcgtggccgccgcccaggagcaggtcggg
aagatcatccacgcgcagtacacgaccgtgatgcacaagcccctcctggagctcaccgac
aagctcggcgaggtcctgccggaggggctggactcggtgttctacgccaactccggctcg
gaggcggttgaggcctccatccgcctggcgcgcatggccgcaggtcgcccgaacatcgtc
gtgttccagggcggcttccacggccgcactgtcgccgcggcctcgctgaccaccgccggc
accaagttctcggcgggcttcgccccgctgatggctggcgtgcacatgtccgcgttcccg
tacgcctaccgctatggctgggatgagccgaccgccgtggagttcgcgctgaaggagctc
gactacctcctgcagacccgcaccgcgccctcggacaccgcggccttcctgatcgagccc
gcgctgggcgacggcggctacatccccacgcctcccgctttcctggaggggctgcgcgag
cgtgccgaccgccacgggatcgtcctcatcttcgacgaggtccaggccggcgtcgggcgc
accgggaagttctggggccaccagcacagctccgcccgcccggacgtcctcatcaccgcc
aagggcatcgcctccggcttcccgatctccgcgatcgccgcctcgaccgagctgatgtcc
aaggcctggcccggctcgcagggcggcacgtacggaggcaacgccgtctcggccgccgcc
ggtgtggccacgctcggggtggtcgagaaggaggggctggtggagaactcccgggtccgc
ggcgagcagctgcaggccggactgaagcagatccagcagcgcttcccggtcatcggcgac
gtccgcggcctggggctcatgcagggcatcgagttcaccgcgccggacggctcccctgat
gccgccaccgccgccgcggtccagcaggccaccacggagcaggacctgctcagcctgacc
tgcggtccggcgggcaacgtcgtgcgcctgatccccgcgctcgtggtgagcgaggaggag
atcgccctgggcctgcagcgcttcgaggcggccgtggaagccgtcgtctcctcggccccg
tccggcaccaccggtgcctga

DBGET integrated database retrieval system