KEGG   Kocuria palustris: KPaMU14_01005Help
Entry
KPaMU14_01005     CDS       T04045                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
kpl  Kocuria palustris
Brite
KEGG Orthology (KO) [BR:kpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kpl01001]
    KPaMU14_01005
Enzymes [BR:kpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KPaMU14_01005
Protein kinases [BR:kpl01001]
 Serine/threonine kinases: Other
  Bacterial family
   KPaMU14_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal RIO1 ABC1 Kinase-like FixS CcmH DUF4106
Motif
Other DBs
NCBI-ProteinID: ALB02436
LinkDB All DBs
Position
complement(228976..231231)
Genome map
AA seq 751 aa AA seqDB search
MEQSPIPELINNRYEVKETIGRGGMATVYKASDRRLGRDVAIKVLKPELARDDSFQERFQ
REAQAVAGLNHHTITSVYDTGEIPPDVPSDIACPYIVMEYVPGQTLRQLIREDRLSTEDA
VNAMEGILDALAYSHRSGIVHRDIKPANVIITPDDRVKVMDFGIARAVEDTQAALTQTQA
VLGTAQYLSPEQARGENVDARSDLYSAACVFFEMLTGRAPFVGEASVDIAAQHVRDAPPR
PSSLAPQLHPQFDTFMLQALAKPRDSRFQSAEEMRRAVVELREPARIDATTMTRPIAATG
AAADGAGEPADGPHTAVTPAAAAGLGAAGGAAAGAAAAGGSSQGQAGQAAPVFTITPSAD
DPSTASAAGGGGSGFDPDAPRGGRTPASDRDRKRRSLLVWLIPLLLLLAAAAVAAFLWLN
RGPEQVDVPDVVGLEADDAQNQLEDAGLVVDTEEELSSDVERDHVISVDPGEGTEVDEGS
SVTITVSQGSEAVTVPSDLEGQSESYAREMISAAGLEAAEETQTRNSPTVPADMVVATDP
EGGSEVPRDSSVGLILSTGRVTVPDVLGMTQSEAADRLGADDTQLGTSVAEERTSEYAAG
TVIRQSVEGGQDVTQGSTITITVAAAPPAPQPTTPEDDGSDEPTSEPTSEEPTEEPTQDP
TEDATEEPTEEPTEEPTQEPSSPAPTADRPSSSSSSGSGGSSASGGSSGSGGSSGSGGSS
RGSGSAPSGSAEDSAARAEEAGSAASSPSEA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtcccccattcccgagctgatcaacaaccgctacgaggtcaaggagaccatc
ggacgcggcggcatggcgaccgtctacaaggcctccgaccggaggctcgggcgcgacgtg
gccatcaaggtgctcaagcccgagctcgcccgcgacgactccttccaggagcggttccag
cgggaggcgcaggcggtcgccgggctgaaccaccacacgatcacctcggtgtacgacacc
ggcgagatcccgccggacgtcccctcggacatcgcctgcccgtacatcgtcatggagtac
gtgccgggccagacgcttcgacagctgatccgcgaggatcggctcagcaccgaggacgcc
gtgaatgccatggagggcatactcgatgccctggcctacagccaccgctcgggcatcgtc
caccgcgatatcaagcccgcgaacgtgatcatcaccccggacgaccgggtcaaggtcatg
gacttcggcatcgcccgcgccgtcgaggacacccaagccgcgctcacccagacccaggcc
gtgctgggcaccgcccagtacctctccccggagcaggctcgcggcgagaacgtcgatgcc
cgctccgatctctactccgcggcctgcgtgttcttcgagatgctcaccggccgggcgccg
ttcgtgggcgaggcctcggtggacatcgcggcccagcacgtccgcgacgcccctccccgg
ccctcgagcctggcgcctcagctgcacccgcagttcgacacgttcatgctccaggcgctg
gccaagccgcgcgactcccgcttccagtccgccgaggagatgcgccgcgccgtcgtcgag
ctgcgcgagcccgcacggatcgacgccacgaccatgacccgtccgatcgccgcgaccgga
gccgccgccgacggcgctggcgagcctgcagacggtccgcacacggccgtcaccccggcc
gcagcggccggtctcggcgcggcgggcggcgctgcagccggtgcggcagcggccggcggc
tcctcccagggtcaggctgggcaggccgcccccgtcttcacgatcacgccgtccgccgat
gacccgagcaccgcctccgcggcgggcggcggcgggtcgggcttcgatccggatgccccg
cgcggcggtcgcaccccggcctcggaccgggaccgcaagcgccgcagcctcctggtctgg
ctgatccccttgctcctgctgctggcggccgcggccgtcgccgcgttcctgtggctcaac
cgcggcccggagcaggtcgacgtcccggatgtcgtgggactcgaggccgatgacgcgcag
aaccagctcgaggacgccggattagtggtcgacaccgaggaggagctcagctccgacgtc
gagcgcgaccacgtgatctccgtcgatcccggcgagggcacggaggtggacgagggctcc
tcggtcacgatcaccgtgtcccagggcagcgaggccgtgacggtcccctcggatctcgag
ggccagtcggagagctacgcccgcgagatgatctccgccgccggcctcgaggccgccgag
gagacgcagacccgcaactccccgaccgtccccgcggacatggtcgtggccaccgatccg
gagggaggctcggaggtcccccgcgactcgtccgtgggactcatcctctccaccggtcgc
gtcaccgtcccggacgtcctgggcatgacgcagtccgaggccgcggatcggctcggcgcc
gatgacacccagctcggcacctcggtggccgaggagcggacctcggagtatgcggccggc
accgtcatccggcagtcggtggagggcggccaggacgtcacgcagggcagcaccatcacg
atcaccgtggcggccgcacccccggctccgcagcccaccacccctgaggacgacggcagc
gacgagcccacctcggagccgacctccgaggagcccacggaggagccgactcaggacccc
acggaggacgccaccgaagagccgaccgaggagcccacggaggagccgacccaggagccc
agctcccccgctccgacggcggaccggcccagcagctcgagcagctccggttcgggcggc
tcctccgcttcgggcggttcgtccggctccgggggctcctccggctccggcggctccagc
cgcggctccggctccgctcccagcggctcggcggaggactccgcagcccgtgccgaggag
gccggcagcgccgcctcgagcccctcggaagcctga

DBGET integrated database retrieval system