KEGG   Kocuria palustris: KPaMU14_02770Help
Entry
KPaMU14_02770     CDS       T04045                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
kpl  Kocuria palustris
Pathway
kpl00220  Arginine biosynthesis
kpl00250  Alanine, aspartate and glutamate metabolism
kpl00290  Valine, leucine and isoleucine biosynthesis
kpl01100  Metabolic pathways
kpl01110  Biosynthesis of secondary metabolites
kpl01130  Biosynthesis of antibiotics
kpl01210  2-Oxocarboxylic acid metabolism
kpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPaMU14_02770
   00290 Valine, leucine and isoleucine biosynthesis
    KPaMU14_02770
   00220 Arginine biosynthesis
    KPaMU14_02770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpl01007]
    KPaMU14_02770
Enzymes [BR:kpl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KPaMU14_02770
    2.6.1.66  valine---pyruvate transaminase
     KPaMU14_02770
Amino acid related enzymes [BR:kpl01007]
 Aminotransferase (transaminase)
  Class I
   KPaMU14_02770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALB02694
LinkDB All DBs
Position
641947..643170
Genome map
AA seq 407 aa AA seqDB search
MRKITQSKKLADVRYDVRGPVLEQAERMEDAGHRILRLNIGNPAPFGFEAPDAVLVDMIK
NLPNAQGYSDSRGIFSARTAVVQYYQTRGIMNLDVSEVFLGNGVSELITMSLQALCDDGD
EILVPSPDYPLWTGATALSGGTPVHYACDEADGWNPDLEDIRAKITPSTRGIVVINPNNP
TGAVYSRETLQGIVDLAKEHDLILFADEIYEKITYDGAEMINLASLCGEDVLCLTFSGLS
KAYRVAGYRSGWLAITGPNWKAESYLEGLKLLSNMRMCANVPAQHAIQTALGGYQSINDL
VLPGGRLKAQRDLAYERLNAIDGVTCEPARGALYLFPKLDVEKFGIEDDERFALDLLKEQ
KILVSHGSAFNLPTPDHFRLVFLPSVEMLATALDRIEEFLGSYHQVR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagatcacccagtccaagaagctcgccgatgtccgctacgacgtccgcggtccg
gtcctcgagcaggcggagcgcatggaggacgcgggacaccgcatcctgcgcctgaacatc
ggcaatcccgcgccgttcggcttcgaagccccggacgccgtgctggtcgacatgatcaag
aacctgccgaacgcgcagggctactcggactcccgcggcatcttctcggcgcgcaccgcg
gtcgtgcagtactaccagacccgcgggatcatgaacctcgacgtctccgaggtcttcctg
ggcaacggcgtctccgagctgatcaccatgtcgctgcaggcgctgtgcgacgacggcgac
gagatcctggtcccctccccggactacccgctgtggaccggggccacggccctgtccggc
ggcacgcccgtgcactacgcctgcgacgaggccgacggctggaacccggatctcgaggac
atccgggccaagatcacgccctccacccggggcatcgtggtgatcaacccgaacaacccc
accggcgcggtctactcgcgcgagaccctgcaggggatcgtcgacctggccaaagagcac
gacctcatcctgttcgccgacgagatctacgagaagatcacctacgacggcgccgagatg
atcaacctggcctcgctgtgcggcgaggacgtcctgtgcctgaccttctcggggctgtcg
aaggcgtaccgcgtggcgggctaccgctccggctggctggcgatcacgggccccaactgg
aaggccgagtcctacctcgaggggctcaagctgctgtccaacatgcgcatgtgcgccaac
gtcccggcccagcacgccatccagacggccctgggcgggtaccagtcgatcaacgacctc
gtcctcccgggcggtcgcctcaaggctcagcgcgatctggcctacgagcggctcaacgcg
atcgacggggtgacctgcgagccggctcgcggcgcgctgtacctgttccccaagctggac
gtcgagaagttcgggatcgaggacgacgagcgcttcgccctggacctgctcaaggagcag
aagatcctggtcagccacggctcggccttcaacctccccacgcccgatcacttccggctc
gtgttcctgccctcggtggagatgctcgccacggcgctggatcgcatcgaggagttcctg
ggcagctaccaccaggtccgctga

DBGET integrated database retrieval system