KEGG   Kocuria palustris: KPaMU14_11340Help
Entry
KPaMU14_11340     CDS       T04045                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpl  Kocuria palustris
Pathway
kpl00020  Citrate cycle (TCA cycle)
kpl00190  Oxidative phosphorylation
kpl00650  Butanoate metabolism
kpl01100  Metabolic pathways
kpl01110  Biosynthesis of secondary metabolites
kpl01120  Microbial metabolism in diverse environments
kpl01130  Biosynthesis of antibiotics
kpl01200  Carbon metabolism
Module
kpl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPaMU14_11340
   00650 Butanoate metabolism
    KPaMU14_11340
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KPaMU14_11340
Enzymes [BR:kpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KPaMU14_11340
    1.3.5.4  fumarate reductase (quinol)
     KPaMU14_11340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4 Fer4_4 Fer4_18 Fer4_21 Fer4_2 Fer4_6 Fer4_3 Fer4_16 Lant_dehydr_N Fer2 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ALB03927
LinkDB All DBs
Position
2579726..2580433
Genome map
AA seq 235 aa AA seqDB search
MRITGTLQVEVWRQADGEAEGGFETHTVTGVSPETTVLELLDLLNEQMPEGVEPISYDDG
CREGICGKCGVTVDGVAHGPQLNRASCQQQVAAFTDGQRVRIEPLRAAAFPVKKDLSVDK
KAALRTVVKAAGGPVGMKALTEAGCISCGACVAACPNGSGQLFVGSLLTELPPLAKDDDD
RRTRSGKVLDAAEESFGPCSTLGDCTEVCPAGLPLENLSAVAREHLRRRRGSADG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaccggcaccctgcaggtcgaggtctggcgccaggccgacggcgaagccgag
ggcggcttcgagacccacaccgtcactggcgtgagcccggagacgaccgtgctggagctg
ctcgacctgctcaacgagcagatgcccgagggcgtggagcccatctcctacgacgacggc
tgccgcgagggcatctgcggcaagtgcggcgtcacggtcgacggcgtggcccacggcccc
cagctcaaccgggcctcgtgccagcagcaggtcgcggccttcaccgacgggcagcgcgtg
cggatcgagccgctgcgcgcagccgccttccccgtgaagaaggacctgtccgtggacaag
aaggccgcgctgcgcaccgtggtcaaggccgccggaggccccgtgggcatgaaggcactg
accgaggccgggtgcatcagctgcggggcctgcgtggccgcctgccccaacggctccggc
cagctgttcgtgggctcgctgctcaccgagctccccccgctggccaaggacgacgacgac
cgccgcacccgctccggcaaggtgctcgacgccgccgaggagagcttcgggccgtgctcc
accctgggcgactgcaccgaggtctgccccgccgggctgcccctggagaacctctccgcg
gtggctcgggagcatctgcgccgccgtcgagggtccgcggacggctga

DBGET integrated database retrieval system