KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_03040Help
Entry
KPHS_03040        CDS       T01733                                 

Definition
(RefSeq) putative S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPHS_03040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpm02000]
    KPHS_03040
Enzymes [BR:kpm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPHS_03040
Transporters [BR:kpm02000]
 Other Transporters
  Pores ion channels [TC:1]
   KPHS_03040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 11845291
NCBI-ProteinID: YP_005224604
UniProt: A0A0H3GM02
LinkDB All DBs
Position
343381..344049
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKTMLAPAALKKIHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQGIDDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGSLLGKGIQKTWLDPQLATHARFIDDHLAARPWFAGERLSMADIQMSFPVM
ALLARGGMHDLVHIEAWRQRVEQRPAWQRAIERGGPFTLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacatcatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggagaaaacgatgctggcgccg
gcggcgctgaaaaaaatccatccgttgggcaaatcaccggtactggaagataacggctat
gtgctggcggagtccggggcgatcctcgagtatttgcaggaaacctgggacagcggcggg
ttgttgaagccgcagggaattgacgacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagccttggcaaaccc
cctgtgccctttggcgttcgctcgctgggttcgctgctgggaaaggggatacagaaaacg
tggctcgatccgcagctggccacccatgcgcggttcattgacgaccatcttgccgcacgg
ccatggttcgctggcgagcggctgagcatggccgatatccagatgagcttcccggtgatg
gcattgttggcgcgcggcggcatgcatgaccttgtccatatcgaggcctggcgtcagcga
gtggaacagcgaccggcctggcaacgcgccatcgagcgcggcggccccttcaccttaccc
ggcgcctga

DBGET integrated database retrieval system