KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_11740Help
Entry
KPHS_11740        CDS       T01733                                 

Definition
(RefSeq) beta-galactosidase 1
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPHS_11740
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KPHS_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-GeneID: 11846172
NCBI-ProteinID: YP_005225474
UniProt: A0A0H3GP41
LinkDB All DBs
Position
1230832..1232889
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDIILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLQINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEMSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAEALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVCQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYQLVIAPMLYMVRDGFAGRAE
AFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHIESAQALATYRDDFYAGRPAVTVNAFGKGKAWHVASRNDLA
FQRDFFTALSKELALPRAIATELPPGVVATARTDGDNAFIFLQNYSAQNHTLTLPQGYRD
CLTDAAVSAPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccacgc
gaaggggtatttaatttcgcctggctggatattatcctcgataaactgtatgccgccggc
attcatgtctttctggccacgccgagcggcgcgcgcccggcgtggatgtcgcagcgctat
ccgcaggttctgcgggtggggcgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgcaaatcaataccctgctggca
gaacgttattcctcacacccggcggtgctgggctggcatatttccaacgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctatactgac
tggtcgcagattgaatcgcctgcgccgcagggcgagatgtcgatccacggtctcaatctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaattgctccg
ctgaaggcggcgaatgcctccctgccggtgactaccaactttatggagtatttctacgat
tacgactactggcagctggcggaggcgctggatttcatctcctgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcgctggcctgttacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccaccccgggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctttcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcagtggtcgaccacgtcggacatattgatacccgcattggc
cgcgaagtctgccagctcggcgagatcctcagcaagctgccggaggtgagaggctgtcgc
accgaggcgaaagtagcgattatcttcgaccagcagaaccgctgggcgctggatgacgcc
caggggccgcgtaatcttgggatggaatatgagaagacggtcaacgagcactaccgcccg
ttctgggagcagggcatcgccgtcgatgtgattgacgccgatgtcgatttaacgccgtat
cagttagtgattgccccgatgttatatatggtgcgcgacggctttgccggtcgggcggag
gcgtttgtcgccaacggcggccacctggtgaccacctactggaccggtatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgcctgaatgacggcgagtttaatctggtgcaggggcttgccggg
aatcagtgcggtctgcagggcccttatcaggtgcgccatctctgcgaactgatccatatc
gagagcgcccaggcgctggccacctaccgggatgatttttatgccggacggccggctgtg
acggtgaacgcgttcgggaaaggcaaagcctggcatgtggcctcccgcaacgatttagcc
ttccagcgcgatttctttaccgccctgagcaaggagctggccctgccgcgggcgatagcg
acggagttaccacccggcgtggtggcgactgcgcgcaccgacggtgacaacgcatttatc
ttcctgcagaactacagcgcgcaaaaccataccctgaccctgccgcaagggtatcgggat
tgcctgaccgacgcggcggtatcggctccactgaccctgtcggcatgggattgccgtatt
ctccgtcgtcacgcgtaa

DBGET integrated database retrieval system