KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_21940Help
Entry
KPHS_21940        CDS       T01733                                 

Definition
(RefSeq) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00061  Fatty acid biosynthesis
kpm00780  Biotin metabolism
kpm01100  Metabolic pathways
kpm01130  Biosynthesis of antibiotics
kpm01212  Fatty acid metabolism
Module
kpm_M00083  Fatty acid biosynthesis, elongation
kpm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KPHS_21940
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPHS_21940
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    KPHS_21940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpm01004]
    KPHS_21940
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     KPHS_21940
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     KPHS_21940
Lipid biosynthesis proteins [BR:kpm01004]
 Fatty acid synthase
  Component type
   KPHS_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 11847212
NCBI-ProteinID: YP_005226494
UniProt: A0A0H3GRQ4
LinkDB All DBs
Position
complement(2238855..2239643)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEEFAAALGSDIV
LPCDVAEDESITALFTELEKVWPKFDGFVHSIGFAPADQLDGDYVDVVTRDGFKIAHDIS
AYSFVAMAKACRGMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSNLSAGI
SGEVVHVDGGFNIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattttgatcactggcgtcgccagcaaactgtccatc
gcctacggcatcgcgcaggcaatgcaccgcgaaggcgcggaactggcattcacctatcag
aatgagaaactgaaaggtcgcgtagaagagtttgctgccgcgctgggttctgacattgtg
ctgccgtgcgacgttgctgaagatgagagcatcaccgcgctgttcaccgagctggaaaaa
gtctggccaaaattcgatggtttcgtccactcaatcggttttgccccggctgaccagtta
gacggcgactacgttgacgttgtcactcgcgacggctttaaaatcgcgcacgacatcagc
gcttacagcttcgtggcaatggccaaagcctgccgcggcatgctgaacccgggttcggct
ctgctgacgctctcctacctgggcgcagagcgcgcgatcccgaactataacgtgatgggt
ctggccaaagcctctctggaagctaacgtccgctatatggctaacgccatgggtccggaa
ggcgttcgcgtcaatgccatctctgccggtcctatccgtacgctggccgcgtccggtatt
aaagatttccgtaaaatgctggcgcactgcgaagcggtcaccccgatccgtcgcaccgtc
accattgaagatgtgggtaacagcgcagccttcctgtgctccaacctgtctgcggggatc
tccggtgaagtcgttcacgttgacggcgggttcaatatcgccgccatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system