KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_23000
Entry
KPHS_23000        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPHS_23000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpm02044]
    KPHS_23000
Secretion system [BR:kpm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPHS_23000
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-GeneID: 11847318
NCBI-ProteinID: YP_005226600
UniProt: A0A0H3GNR3
LinkDB
Position
2329665..2330354
AA seq 229 aa
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRDEEGYTLWQRCIADVERVQHELKAS
GLDDVSCQHILTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCERMRD
VLREPAPNLAVVTCFQRVMLLGFIGSFRSLHDPERLKLVNALGERVPPFQCPATAPVLVE
SRAGLGISGWLAPWPVRIGLSVVVVLALWWGLNHWLDHLLLTLLPGEVK
NT seq 690 nt   +upstreamnt  +downstreamnt
gtgaatgagcctaaacgcggcaacgccgcgtccattgatattgatgcgctgctgcagaac
acctggctgcaggttatcagcctgcgccacggcccgcagttccgcgatgaggaagggtac
acgctatggcagcgctgtattgctgatgtcgagcgcgtgcaacatgagctgaaggcgagc
gggcttgatgacgtcagctgtcagcatattctcaccgcccagtgcgcgctgctcgatgaa
gcagtgaaaggtcgcggcgtggaggatgaggcctgcctgcagtggtatgacattccgctg
caggggcacttcctcggcaccatggacgccggcgacaccctgtgcgagcggatgcgtgat
gtgttgcgtgaaccggcgcccaacctggccgtggtcacctgttttcagcgggtgatgctg
ctgggttttattggcagctttcgctccctccacgaccccgagcgcctgaagctggtcaac
gcgctcggtgagcgtgttcctccttttcagtgcccggctaccgctcccgtactggtagag
agtcgcgccggtctggggataagcggctggctggccccatggccggtacgtattggcctg
agcgtggtggtggtactcgccctgtggtggggactcaaccactggctcgatcacctgctg
ctgaccttgttaccgggggaggtgaaatga

DBGET integrated database retrieval system