KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_28030Help
Entry
KPHS_28030        CDS       T01733                                 

Definition
(RefSeq) putative glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00500  Starch and sucrose metabolism
kpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPHS_28030
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KPHS_28030
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     KPHS_28030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 11847821
NCBI-ProteinID: YP_005227103
UniProt: A0A0H3GTX2
LinkDB All DBs
Position
complement(2807109..2808734)
Genome map
AA seq 541 aa AA seqDB search
MQREEWFHRAVIYQVDSSLFYDANGDGFGDLAGIRQKLHYIRSLGATVLWLTPFYLTPLQ
DDGYDISDHLQPDPRFGTIADVIELIARARELGLRVIVELVIQHTSAQHPWFQAARRDPR
SPWRPYYLWADRPPENDDPPMFPGVEESVWRWDEQAGQYYRHMFYHHEPDLNLAHPPVIA
EIENIITFWLQAGVSGFRLDAASHLVKQAGKGDETRGYPLLTHLRQVVQRLNPDAILLGE
VDVAVEDYRHYFGQGDRLQMVLNFWLNKYLYLSLAQQRAAPVVKALQAMVTPPDGCCFVN
WLRNHDELDLEGIGERNKRQVIRTFAPDKSMSVYQRGVRRRLAPMLDGDTRRIALAHAIL
LALPGVPVMRYGDEIGMGDDLSLPERYAVRTPMQWSAAANAGFSRAARDDLPVKPVASGR
FRYQRINVETALRHPRSLLHRVRNMVLARTEYTEPGSLPFTLLTLKPDAVLGLLYRSESR
EVLMLANCSQQAVEVLLPPLAEGYWSPILEDKLYQDGLHGGKDARLALSGYGYRWFSRSL
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgggaagagtggtttcacagagcggtcatctatcaggttgacagttcgctcttt
tatgatgccaatggcgatggttttggcgatctcgcgggcattcgccaaaagctacactac
attcgcagcctcggagcgacggtgctctggctgactccgttctatctcactcctctgcag
gatgatggctatgatatcagcgatcatctgcagcccgatccgcggttcggcactatcgct
gacgtgattgagctgattgcccgcgcccgcgagctgggactgcgggtgatcgttgagctg
gtgatccagcacacctccgcgcagcacccgtggttccaggcggcgcgacgcgatccccgg
tcgccgtggcggccgtattatctgtgggccgatcggccgccggaaaacgacgatcctccc
atgtttcccggcgttgaggagagcgtctggcgctgggacgaacaggctgggcaatattat
cgccacatgttttatcaccacgagcccgacctgaatctcgcccatccgccggtgatcgct
gaaatcgaaaacattatcaccttctggctgcaggctggggtgtctggctttcgtctcgat
gccgcgtcacatctggtcaagcaggccggaaagggcgacgagacgcgcggctacccgctg
ctgacccatctccggcaggttgtacagcgcctcaatcccgatgcgatactcctgggtgaa
gtggacgtcgcggtagaagattaccgtcattatttcggccagggcgatcggctgcagatg
gtgcttaatttctggcttaacaaatacctctacctcagcctggcgcagcagcgcgccgcg
ccggtggtgaaggccctgcaggcgatggtgaccccgccggacgggtgctgcttcgtcaac
tggctgcgcaaccatgatgaactggatcttgaggggattggcgagcgcaacaagcgccag
gttatccgcacctttgcccctgataaatcgatgtccgtttaccagcgcggcgtacgccga
agactggcgccgatgctggacggcgatacccgacgcatagcgttagcccatgctatcctg
ctggcgctgcccggcgtgccggtgatgcgctatggcgacgagattggcatgggtgacgat
ctctccttaccggagcgctacgcggtcagaacgccgatgcagtggtcggccgcggccaac
gccggcttttcccgggcggcgcgggatgatttgccggtaaaaccggtggccagcgggcgg
ttccgctaccaacggatcaatgttgaaacggcgctgcgccatcccaggtcgctgctgcat
cgggtacgcaatatggtattggcgcgcacggaatatactgaaccgggatccctccctttt
actctccttaccctaaagcccgacgcggtgctgggcttgctctatcgcagcgaatcgcgg
gaggtactgatgctggccaactgcagccagcaggcggtagaggtcctgctcccgccgctg
gccgagggctactggagcccaattctggaagataagctctatcaggatgggctgcacggc
gggaaagatgcgcggctggcactctccgggtatggttaccgttggttcagccgcagcctg
agttag

DBGET integrated database retrieval system