KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_42590Help
Entry
KPHS_42590        CDS       T01733                                 

Definition
(RefSeq) cobalt-precorrin-6Y C(15)-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
kpm00860  Porphyrin and chlorophyll metabolism
kpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPHS_42590
Enzymes [BR:kpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     KPHS_42590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PCMT Methyltransf_31 Cons_hypoth95 GidB PrmA Methyltransf_4 Methyltransf_25 Methyltransf_18 Methyltransf_12 Methyltr_RsmB-F Met_10 Methyltransf_11 CMAS Methyltransf_23 UPF0020 Methyltransf_2 RrnaAD DOT1
Motif
Other DBs
NCBI-GeneID: 11849310
NCBI-ProteinID: YP_005228559
UniProt: A0A0H3GWZ3
LinkDB All DBs
Position
complement(4292504..4293073)
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGAQVPMTKEAVRALALAKLELHRARHLIDIGAGTGSVSIEAALQNPALRVTA
IERQADALRLLAENRQRFGCDNIAIVAGVAPLAVADKADAIFMGGSGGHLTALIDWSLAQ
LHPGGRLVMTFILQENLHSALAHLRQSGIHEVDCQQLAVSTLATLGSGHYFKPHNPVFVI
ACQKEENHG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctgtttttgcgcggcgcccaggtgccgatgaccaaagaggccgtgcgc
gcgctggcgctggcgaagctggagctgcaccgggcgcgccatctgattgatatcggcgcg
ggcaccggcagcgtcagcattgaggctgctctacagaacccggcgctgcgggtgacggcg
attgagcgtcaggccgacgcgctgcgcctgctggcggagaaccggcagcgctttggctgc
gacaacatcgctatcgtggcgggcgttgcgccgctggcggtcgccgacaaagccgacgcg
atctttatggggggcagcggcggccacctgacggcgctgatcgactggtcgctggcgcag
ctgcatcctggcggccggctggtgatgacttttattttgcaggaaaaccttcatagcgcc
ctggcgcacctgcggcagagcggcatccacgaggtggactgccagcagctggcggtctcc
accctggctaccctgggcagcggccactacttcaaaccccataatcccgtttttgtcatc
gcctgtcagaaggaagaaaaccatggctga

DBGET integrated database retrieval system