KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_45110
Entry
KPHS_45110        CDS       T01733                                 

Definition
(RefSeq) hypothetical protein
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-GeneID: 11849564
NCBI-ProteinID: YP_005228811
UniProt: A0A0H3H308
LinkDB
Position
complement(4538363..4539010)
AA seq 215 aa
MLLVSLIFSLIVEYVGIAFFWPEEGALHSKAVMETESRYFSEEFTRSLLLSDPVVTVECW
LTLAYQWLFVDSGFLGWLNAPHADQGNDFTRTLNGGAAWLLVKLREYLLATVYVTLVFLI
RVTILVLSVPLFVMVAAIGIVDGLVRRDLRRYGAAYESSFIYHHAKRWIKPATCLPCVIY
LSMPFAVYPNILLLPAALLLGLVISLTTGAFKKYL
NT seq 648 nt   +upstreamnt  +downstreamnt
atgttactcgtgtcgctgattttcagcctgatcgttgagtatgtcggcattgccttcttc
tggcctgaagaaggagccctgcacagcaaagcggtcatggagacggaaagccggtatttc
tctgaagaattcacccgcagcctgctgctgtctgacccggtggtgacggtagagtgttgg
ctgacgctggcgtatcagtggctgtttgtggacagcggttttctgggctggttgaatgcc
ccccacgcagatcaaggcaacgactttacccggacgctaaacggcggcgcggcctggctg
ctggtgaagctgcgggagtatctgctggcgacggtgtacgtgacgctggtttttcttatt
cgggtcacaattttggtgctgtctgtgccgctgtttgtgatggtggcagcgatcggcatc
gtggacggcctggttcggcgcgatttgcgccgctacggcgcggcgtatgagagcagcttt
atctatcaccacgccaagcgctggattaaaccggcgacctgtttaccctgcgttatctac
ctgtcgatgccgtttgcggtatatcccaatattcttctgctgcctgcggcgctgctgctg
gggttggtgatttcgttgacgaccggggcgtttaagaagtatttgtga

DBGET integrated database retrieval system