KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_00323Help
Entry
KPN_00323         CDS       T00566                                 

Gene name
ddl
Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00473  D-Alanine metabolism
kpn00550  Peptidoglycan biosynthesis
kpn01100  Metabolic pathways
kpn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KPN_00323 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPN_00323 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KPN_00323 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpn01011]
    KPN_00323 (ddl)
Enzymes [BR:kpn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KPN_00323 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:kpn01011]
 Precursor biosynthesis
  Amino acid ligase
   KPN_00323 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ABR75775
UniProt: A6T5A4
LinkDB All DBs
Position
complement(363157..364287)
Genome map
AA seq 376 aa AA seqDB search
MPFDVIWMEVEMAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKSRFDVVLLGIDKQGLW
HINDAGNYLLNAQDPARIALRPSTVTLAQIPGREAQQLINAESGQPLAAIDVIFPIVHGT
LGEDGSLQGMLRMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLAVAPFITLTRANRAQF
SFADVEAKLGLPLFVKPANQGSSVGVSKVKNEEQYHQAVALAFEFDHKVVVEQGIKGREI
ECAVLGNDHPQASTCGEIVLNSEFYAYDTKYIDDQGAQVVVPAAIAPEINDKIRAIAVQA
YQTLGCSGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLDYTSLITRLIEL
ALERHAADRALKTSMN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgatgttatctggatggaagttgaaatggcaaagatgagggttgggatcgtt
tttggcggcaagtcggcggagcatgaagtgtcgctgcagtcagcgaagaatatcgtggaa
gcgattgataaatcgcgcttcgatgtggttctgttgggtattgataaacaggggctgtgg
catatcaacgacgccggcaactacctgctcaacgcacaggatcctgcccgcattgccctg
cgcccttccacggtgactctggcgcagatcccgggccgcgaagcgcagcagctgattaac
gccgaaagcggccaaccgctggcggccatcgatgtgattttcccgatcgtccacggcacg
ctgggtgaagatggctccctgcaggggatgctgcgcatggcgaatctgccgttcgtcggc
tccgatgtgctgggctctgcggcctgtatggacaaagacgtgaccaaacgtctgctgcgc
gacgccgggctcgccgtcgccccgtttatcacactcacccgcgccaaccgcgcgcagttc
agctttgccgatgtcgaagcgaagcttggcctgccgctgttcgttaagccggctaatcag
ggctcgtcggttggcgtcagcaaagttaaaaacgaagagcagtaccatcaggcggtggcc
ctggccttcgaatttgaccataaagtggtggtggagcaaggcattaaagggcgggaaatt
gagtgtgcggtgctgggtaacgaccacccgcaggccagcacctgcggtgaaatcgtcctc
aacagcgagttttacgcctacgacaccaagtatatcgacgatcagggcgcgcaggtggta
gtcccggccgctatcgcccctgagatcaacgacaaaattcgcgctatcgcggtgcaggcc
taccagaccctgggctgcagcggcatggctcgtgtcgacgtgttcctcaccgccgacaac
gaggtggtgatcaacgagatcaacaccctgccgggctttaccaacatcagcatgtatccg
aagctgtggcaggccagcggtctcgactacaccagcctgatcacccgcctgattgagctg
gcgttggagcgccatgccgcggaccgggcgctgaaaacctccatgaactaa

DBGET integrated database retrieval system