KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01144Help
Entry
KPN_01144         CDS       T00566                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00020  Citrate cycle (TCA cycle)
kpn00480  Glutathione metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
kpn01210  2-Oxocarboxylic acid metabolism
kpn01230  Biosynthesis of amino acids
Module
kpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPN_01144 (icdA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KPN_01144 (icdA)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KPN_01144 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ABR76577
UniProt: A6T7K6
LinkDB All DBs
Position
1298996..1300246
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTHVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaatggcaaa
ctgaacgtccctcacaatccgattatcccgtttattgaaggtgacggtatcggcgttgac
gttaccccagcgatgctgaaagtggttgatgccgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgagaaatcaacccacgtctatggccag
gacgtctggctgccagctgaaaccctcgatctgattcgtgactaccgcgttgctatcaaa
ggtcctctgaccaccccagtcggcggcggcattcgttctctgaacgtggcgctgcgccag
gagctggatctttacgtctgcctgcgtccggtacgttactaccagggcaccccgagcccg
gttaaacacccggaactgaccgacatggttatcttccgtgaaaactcagaagatatctat
gcgggtatcgagtggaaagccgactctgcggaagcagacaaagtgatcaaattcctgcgc
gatgagatgggtgtgaagaaaattcgcttcccggaacattgcggcatcggcatcaagccg
tgctctgaagaaggcaccaaacgcctggtgcgcgccgcgattgaatacgcgatcaccaac
gatcgtgattccgtcactctggtgcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggctaccagctggctcgcgaagagttcggcggcgagctgatcgacggc
ggtccgtgggtgaaaatcaagaacccgaacaccggtaaagagatcgtggtgaaagacgtg
atcgccgatgcgttcctgcagcagatcctgctgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggcgactatatctctgacgccctggcggcgcaggttggcggtatc
ggtatcgccccgggcgccaacatcggtgacgagtgcgcgctgttcgaagcgactcacggt
actgcgccgaagtatgccggccaggacaaagtgaacccgggctccatcatcctgtccgca
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgtcaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagaatttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system