KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01317
Entry
KPN_01317         CDS       T00566                                 

Definition
(GenBank) hypothetical protein
  KO
K04757  serine/threonine-protein kinase RsbW [EC:2.7.11.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kpn01001]
    KPN_01317
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:kpn03021]
    KPN_01317
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KPN_01317
Protein kinases [BR:kpn01001]
 Serine/threonine kinases: Other
  Bacterial family
   KPN_01317
Transcription machinery [BR:kpn03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     KPN_01317
SSDB
Motif
Pfam: HATPase_c_2
Other DBs
NCBI-ProteinID: ABR76749
UniProt: A6T828
LinkDB
Position
1477764..1478072
AA seq 102 aa
MDASVAVAFKAAVSREIFAANDRVTLRFIDAGEIFPAERLALARNDEHFDVDPLAEGGRG
LRLILRAVDYFNVETGAGENVTTLIEALPDTRLSHATDDRCG
NT seq 309 nt   +upstreamnt  +downstreamnt
ttggatgcttccgtcgcagtggcctttaaagcggcagtctcccgggaaattttcgctgcc
aatgaccgcgtgacactgcgctttatcgatgcgggagagatctttcctgccgaacgcctg
gcgctggcgcgtaacgatgagcactttgatgtcgatccgttagcggaaggcggcagaggc
ttgcggcttattctgcgtgcggtggactattttaatgtggaaactggcgccggggagaat
gtgactaccctgatagaagcgttgcctgatacccgcctaagccatgccaccgacgatcgc
tgcgggtga

DBGET integrated database retrieval system