KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_01770Help
Entry
KPN_01770         CDS       T00566                                 

Definition
(GenBank) putative amidase
  KO
K22601  oxamate carbamoyltransferase [EC:2.1.3.5]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00230  Purine metabolism
kpn01100  Metabolic pathways
kpn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KPN_01770
Enzymes [BR:kpn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.5  oxamate carbamoyltransferase
     KPN_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABR77201
UniProt: A6T9D0
LinkDB All DBs
Position
1951764..1953161
Genome map
AA seq 465 aa AA seqDB search
MTLQHFTIADLQRALHDGELSAREIARQTLDDIARVNPQINAWTEVTAQRMLAEADSIDA
LRREKRPLPPLAGIPYAVKNLFDVAGHTTLAGAELLSDRPPATSDSWAVRQLHSAGALLS
GMLNMDAYAYGFTTENSHYGATRNPHDLSRIAGGSSGGSAAAVAAGLVHFSLGSDTNGSI
RVPASLCGIFGLKPTFGRLSRSGSHPFVASLDHIGPFARRVADLAAVYDALQGRDPADDF
QADKASERTGNLLERGLEGLRCARLGGYFTTWCDDDARAAVDRVAHALGADSELQFADAA
LARSAAFIISASEGGNQYLTDLRHSPERFEPHSRERLLAGAMIPSAWYLQAQRFRRHARQ
AMKSLFSQADVLIAPATPCSATPIGAEEMVINGQPLPVRASMGMLTQPISFLGLPVVTVP
LRTASGKPIGLQLIAAPFNEQACLRAARALEAMGITDARVAESAA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcaacacttcaccattgccgatctccagcgtgcgctgcacgatggcgaactg
agcgcccgggagatcgcccgccagacgctggacgatatcgcccgcgtgaatccgcagatc
aacgcctggaccgaggtcaccgcccagcgcatgctggcggaggccgacagcatcgacgcc
ctgcgccgggaaaagcgccccctgccgccgctggcaggcattccttacgcagtgaaaaat
ctgtttgatgtcgccgggcataccaccctcgccggcgccgaactgctgagcgaccggccg
ccagcgaccagcgacagctgggcggtgcgccagctgcacagcgccggcgccctgctcagc
gggatgctcaatatggacgcctacgcctacggcttcaccaccgaaaacagccactatggc
gcgacgcgcaacccgcacgatctgtcgcggatcgccggcggttcttccggcggttcggcc
gcggcggtggcggccgggctggttcatttcagcctcggcagcgacaccaacggctcgatc
cgcgtccccgcgtcgctgtgcgggatctttggcctgaaacccactttcgggcgcctgtcg
cgctctggcagccatccgtttgtcgccagtctggatcatattggtccttttgcccgccgg
gtagccgacctcgccgcggtgtatgacgccctgcaggggcgcgacccggccgatgacttt
caggctgataaagccagcgagcgcaccggcaatctgctggaacgcggactggaggggctg
cgctgcgcgcggctgggcggctatttcaccacctggtgcgatgacgacgcccgggcggcc
gtggatcgggtcgcccacgcgctgggcgccgacagcgagctgcagttcgcggatgccgcg
ctggcccgctcggcggcctttatcatcagcgccagcgaaggcggcaatcagtacctgacg
gatcttcgccactcgcccgagcgctttgaacctcactcccgcgagcggctgctggccggc
gcgatgatcccctccgcgtggtatctgcaggctcagcgttttcgccgtcatgcccgtcag
gcaatgaaatccctgttcagccaggccgacgtgctgatcgccccggccaccccatgcagc
gccacgccaataggcgcggaggagatggtgattaacggccagccgctgccggtgcgcgcc
agcatgggaatgctgacgcagccgatctccttcctcgggctgccggtggtgaccgtgccc
ctgcgtaccgccagcggcaagccgattggcctgcagctgattgccgcgccgtttaacgaa
caagcctgtcttcgcgccgcgcgggcgctggaagcgatgggcattaccgatgcccgagtg
gcggagagtgcagcatga

DBGET integrated database retrieval system