KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01838Help
Entry
KPN_01838         CDS       T00566                                 

Definition
(GenBank) putative glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00500  Starch and sucrose metabolism
kpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPN_01838
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KPN_01838
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     KPN_01838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABR77269
UniProt: A6T9J8
LinkDB All DBs
Position
complement(2027360..2028985)
Genome map
AA seq 541 aa AA seqDB search
MQREEWFHRAVIYQVDSSLFYDANGDGFGDLAGIRQKLHYIRSLGATVLWLTPFYLTPLQ
DDGYDISDHLQPDPRFGTIADVIELIARARELGLRVIVELVIQHTSAQHPWFQAARRDPR
SPWRPYYLWADRPPENDDPPMFPGVEESVWRWDEQAGQYYRHMFYHHEPDLNLAHPPVIA
EIENIITFWLQAGVSGFRLDAASHLVKQAGKGDETRGYPLLTHLRQVVQRLNPDAILLGE
VDVAVEDYRHYFGQGDRLQMVLNFWLNKYLYLSLAQQRAAPVVKALQAMVTPPDGCCFVN
WLRNHDELDLEGIGERNKRQVIRTFAPDKSMSVYQRGVRRRLAPMLDGDTRRIALAHAIL
LALPGVPVMRYGDEIGMGDDLSLPERYAVRTPMQWSAAANAGFSRAARDDLPVKPVASGR
FRYQRINVETALRHPRSLLHRVRNMVLARTEYTEPGSLPFTLLTLKPDAVLGLLYRSESR
EVLMLANCSQQAVEVLLPPLAEGYWSPILEDKLYQDGLHGGKDARLALSGYGYRWFSRSL
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgggaagagtggtttcacagagcggtcatctatcaggttgacagttcgctcttt
tatgatgccaatggcgatggttttggcgatctcgcgggcattcgccaaaagctacactac
attcgcagcctcggagcgacggtgctctggctgactccgttctatctcactcctctgcag
gatgatggctatgatatcagcgatcatctgcagcccgatccgcggttcggcactatcgct
gacgtgattgagctgattgcccgcgcccgcgagctgggactgcgggtgatcgttgagctg
gtgatccagcacacctccgcgcagcacccgtggttccaggcggcgcgacgcgatccccgg
tcgccgtggcggccgtattatctgtgggccgatcggccgccggaaaacgacgatcctccc
atgtttcccggcgttgaggagagcgtctggcgctgggacgaacaggctgggcaatattat
cgccacatgttttatcaccacgagcccgacctgaatctcgcccatccgccggtgatcgct
gaaatcgaaaacattatcaccttctggctgcaggctggggtgtctggctttcgtctcgat
gccgcgtcacatctggtcaagcaggccggaaagggcgacgagacgcgcggctacccgctg
ctgacccatctccggcaggttgtacagcgcctcaatcccgatgcgatactcctgggtgaa
gtggacgtcgcggtagaagattaccgtcattatttcggccagggcgatcggctgcagatg
gtgcttaatttctggcttaacaaatacctctacctcagcctggcgcagcagcgcgccgcg
ccggtggtgaaggccctgcaggcgatggtgaccccgccggacgggtgctgcttcgtcaac
tggctgcgcaaccatgatgaactggatcttgaggggattggcgagcgcaacaagcgccag
gttatccgcacctttgcccctgataaatcgatgtccgtttaccagcgcggcgtacgccga
agactggcgccgatgctggacggcgatacccgacgcatagcgttagcccatgctatcctg
ctggcgctgcccggcgtgccggtgatgcgctatggcgacgagattggcatgggtgatgat
ctctccttaccggagcgctacgcggtcagaacgccgatgcagtggtcggccgcggccaac
gccggcttttcccgggcggcgcgggatgatttgccggtaaaaccggtggccagcgggcgg
ttccgctaccaacggatcaatgtcgaaacggcgctgcgccatcccaggtcgctgctgcat
cgggtacgcaatatggtattggcgcgcacggaatatactgaaccgggatcactccctttt
actctccttaccctaaagcccgacgcggtgctgggcttgctctatcgcagcgaatcgcgg
gaggtactgatgctggccaactgcagccagcaggcggtagaggtcctgctcccgccgctg
gccgagggctactggagcccaattctggaagataagctctatcaggatgggctgcacggc
gggaaagatgcgcggctggcactctccgggtatggttaccgttggttcagccgcagcctg
agttag

DBGET integrated database retrieval system