KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_03621Help
Entry
KPN_03621         CDS       T00566                                 

Definition
(GenBank) putative dehydrogenase, NAD(P)-binding, starvation-sensing protein
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Pathway
kpn00040  Pentose and glucuronate interconversions
kpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPN_03621
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     KPN_03621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH TrkA_N DapB_N PALP NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABR79014
UniProt: A6TEN0
LinkDB All DBs
Position
3977027..3978058
Genome map
AA seq 343 aa AA seqDB search
MEGIKMRSVVVKEPGQLNIESRPVPVPGAHEVRVKIAFAGICGSDVHIYHGHNPFAKYPR
VIGHEFYGIIDAVGEQVSPARIGERVAVDPVVSCGHCYPCSVGRPNVCTQLQVIGVHRDG
GFSDYACVPAKNAWRIPEAISDRQATMVEPFTIAANITAQLQPTAQDIALVYGAGPMGLT
IIQALKGVYGVKQVIVVDRIAERLQMARENGADLTLDNTDQPLAEQLAQRQLAPTLVIDA
ACHPAILQEAILLASPAARIGILGFSGEASTLTQQSITSKEISIFSSRLNSGRFPLVIDW
MEKGLIRPEALITHCMPLEQVKEAMEIFANDRKTCCKVLLQLG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatcaaaatgagaagcgtcgtcgtcaaagagccaggccaactgaacattgaa
tcacgtccggttccagttccgggcgcccatgaagtacgggtgaaaattgcttttgccggg
atctgtggttccgatgtacacatctatcacggccacaaccctttcgcgaaatatccccgc
gtcatcggccatgaattctatggcatcatcgacgccgtcggcgagcaggtatctccggca
cgcatcggcgagcgtgtcgcggtggaccccgttgtcagctgcggccattgttatccttgc
tcggtaggaaggccgaatgtctgtacgcagctccaggtcataggagttcaccgcgacggg
ggatttagcgactatgcctgcgtgccggcgaaaaatgcctggcgcatccccgaggctatc
agcgaccgtcaggcaacgatggttgagccttttaccatcgcggcaaatattaccgcccag
ctgcagcccacggcgcaagatattgccctggtttacggcgctggcccgatggggctgaca
atcattcaggcgctaaagggggtatatggcgttaagcaggtgatcgtcgtggatcgcatt
gccgaacgtctgcagatggcccgggaaaacggcgccgatctgacgctcgataacactgac
cagccgctcgcggaacagctggcgcagcggcagcttgcccccacgctggtcattgatgcc
gcctgccacccggcgatcctgcaggaagccattctcctcgcctcccccgccgcccgcatc
ggtatactcggtttctccggcgaggcctcaaccctcactcagcaaagcatcaccagtaaa
gaaatttctattttctcctcccggctgaacagcgggcgttttccgctggtcatcgactgg
atggagaaaggccttattcgtccggaggcgttaatcacccattgtatgccgctggagcag
gtgaaagaggccatggagatttttgctaacgaccgtaagacctgctgcaaagtgctgctg
cagctgggttaa

DBGET integrated database retrieval system