KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52): KPN_03628Help
Entry
KPN_03628         CDS       T00566                                 

Gene name
sspA
Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (serotype K52)
Brite
KEGG Orthology (KO) [BR:kpn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:kpn03021]
    KPN_03628 (sspA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpn02000]
    KPN_03628 (sspA)
Transcription machinery [BR:kpn03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     KPN_03628 (sspA)
Transporters [BR:kpn02000]
 Other transporters
  Pores ion channels [TC:1]
   KPN_03628 (sspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-ProteinID: ABR79021
UniProt: A6TEN7
LinkDB All DBs
Position
complement(3988355..3988993)
Genome map
AA seq 212 aa AA seqDB search
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMQRIEKDWYSLMNTIQSG
TAAQADAARKQLREELLAIAPVFTQKPYFLSDEFSLVDCYLAPLLWRLPVLGVELVGAGA
KELKGYMTRVFERDSFLASLTEAEREMRLGRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgccaacaaacgttcggtaatgacgctgttttctggtcctactgacatc
tatagccatcaggtccgcattgtgctggccgagaagggtgtcagttttgagatagagcac
gtggagaaggataacccgcctcaggatctgattgacctcaacccgaatcaaagcgtaccg
acgctggtggatcgtgagctcactctgtgggaatcccgcatcattatggagtatctggat
gagcgtttcccgcacccgccgttaatgccggtttatccggtggcgcgtggtgaaagccgc
ctgtatatgcaacgtatcgagaaggactggtattcgctgatgaacaccatccagagcggt
accgcagcgcaagctgatgctgcgcgtaagcagctgcgtgaagaattgctggccatcgcg
ccggtcttcacccagaaaccttacttcctgagcgatgagttcagcctggtggactgctac
ctggcgccgctgctgtggcgtctgccggttcttggtgtggagctggttggcgctggcgcg
aaagagctcaaaggctatatgactcgcgtatttgagcgtgattccttcctcgcttcttta
actgaagccgagcgtgaaatgcgcctcggtcggggctaa

DBGET integrated database retrieval system