KEGG   Klebsiella pneumoniae 32192: KU54_001825Help
Entry
KU54_001825       CDS       T03746                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpne01100  Metabolic pathways
kpne01110  Biosynthesis of secondary metabolites
kpne01130  Biosynthesis of antibiotics
kpne01230  Biosynthesis of amino acids
Module
kpne_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KU54_001825 (aroK)
Enzymes [BR:kpne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     KU54_001825 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE ABC_tran APS_kinase AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_2 AAA_28 His_biosynth AAA_29 RsgA_GTPase PduV-EutP AAA_24 Mg_chelatase MMR_HSR1 GTP_EFTU IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: AJB55562
UniProt: A0A0V9SMA6
LinkDB All DBs
Position
390182..390703
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDAPPREVLEALADERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgccagttagcccaacagctcaacatggaattttacgattctgatcaagagattgag
aaacgcactggcgctgatgtgggctgggtcttcgatgttgaaggcgaagaaggcttccgc
gaccgtgaagagaaaattatcaatgagttgacggaaaaacaggggattgtgctggcgact
ggcggcggctctgtaaaatcccgtgaaacgcgtaaccgtctctccgcccgcggcgtggtg
gtctacctggaaactacgatcgagaagcagttggcccgtacgcagcgcgataaaaagcgt
cctttgctacaagtcgatgcgccgcctcgtgaagtgctggaagcgctggctgacgagcgt
aacccgctgtatgaagagatcgccgatgtgactatccgcacagacgatcagagtgcgaaa
gtcgtcgcgaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system