KEGG   Klebsiella pneumoniae 32192: KU54_003840
Entry
KU54_003840       CDS       T03746                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4693 family
Organism
kpne  Klebsiella pneumoniae 32192
SSDB
Motif
Pfam: ssDNA-exonuc_C Glutaredoxin
Other DBs
NCBI-ProteinID: AJB55943
UniProt: A0A210UWN3
LinkDB
Position
756099..756716
AA seq 205 aa
MAGKLEQANTRKSAQTWGLTDEEWQRYQALMNGRRGVFSPDLDPITALGIEARTAEERRR
FAELSVQQDFKRVEAELAFQREVDAAWKRLYPHILPIGAGMGSAPAQPRSHGRLALFVKA
DCPPCDKTLTKLLASQKPFDIYLVGSEGQDAKVREWASRRHIPAERVKTRAITLNHDAGR
WLKLGKGQMPVVLEQGENGWLPVAF
NT seq 618 nt   +upstreamnt  +downstreamnt
gtggccggaaagcttgagcaggcgaacacccgtaaaagcgctcagacatggggactgacc
gacgaggagtggcaacgctatcaggcgttaatgaatggacggcgcggcgtattctctccc
gatctggacccgattacggcgctgggcattgaagccagaacggcggaagagcgccgccgc
tttgccgaactgtccgtccagcaggactttaagcgcgtggaggccgagctggcgtttcag
cgggaggtcgacgcggcgtggaaacggctttacccccatattctgccgattggcgcaggt
atgggcagcgcgccagctcagccccggagtcatggccgtctggcgctgtttgtcaaagcg
gactgcccgccctgtgataaaacgctgacgaagctgctcgccagccagaagccgtttgat
atttatctggtcggtagcgaaggccaggacgcgaaggtacgtgagtgggcgagcaggcgg
catattcccgctgaacgcgtaaaaacgcgggcgattacgctcaaccatgacgctggtcgc
tggctgaagttaggcaaaggccaaatgcccgtggtgctggaacagggggaaaacggatgg
ttgcccgtcgcgttctga

DBGET integrated database retrieval system