KEGG   Klebsiella pneumoniae 32192: KU54_003865
Entry
KU54_003865       CDS       T03746                                 

Definition
(GenBank) membrane protein
Organism
kpne  Klebsiella pneumoniae 32192
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: AJB55948
UniProt: A0A1V8B6Z2
LinkDB
Position
760170..760928
AA seq 252 aa
MAQPGASTTAPRQQEVPRRPPGLLSNVFWHWPWQLVGMLLVSLIFSLIVEYVGIAFFWPE
EGALHSKAVMETESRYFSEEFTRSLLLSDPVVTVECWLTLAYQWLFVDSGFLGWLNAPHA
DQGNDFTRTLNGGAAWLLVKLREYLLATVYVTLVFLIRVTILVLSVPLFVMVAAIGIVDG
LVRRDLRRYGAAYESSFIYHHAKRWIKPATCLPCVIYLSMPFAVYPNILLLPAALLLGLV
ISLTTGAFKKYL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcgcagcccggggcttcaaccactgccccacgccagcaggaggttccccggcgtccg
ccggggctgctatcgaacgtgttctggcactggccctggcagctagttggcatgttactc
gtgtcgctgattttcagcctgatcgttgagtatgtcggcattgccttcttctggcctgaa
gaaggagccctgcacagcaaagcggtcatggagacggaaagccggtatttctctgaagaa
ttcacccgcagcctgctgctgtctgacccggtggtgacggtagagtgttggctgacgctg
gcgtatcagtggctgtttgtggacagcggttttctgggctggttgaatgccccccacgca
gatcaaggcaacgactttacccggacgctaaacggcggcgcggcctggctgctggtgaag
ctgcgggagtatctgctggcgacggtgtacgtgacgctggtttttcttattcgggtcaca
attttggtgctgtctgtgccgctgtttgtgatggtggcagcgatcggcatcgtggacggc
ctggttcggcgcgatttgcgccgctacggcgcggcgtatgagagcagctttatctatcac
cacgccaagcgctggattaaaccggcgacctgtttaccctgcgttatctacctgtcgatg
ccgtttgcggtatatcccaatattcttctgctgcctgcggcgctgctgctggggttggtg
atttcgttgacgaccggggcgtttaagaagtatttgtga

DBGET integrated database retrieval system