KEGG   Klebsiella pneumoniae 32192: KU54_007840Help
Entry
KU54_007840       CDS       T03746                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00564  Glycerophospholipid metabolism
kpne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KU54_007840
Enzymes [BR:kpne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KU54_007840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_oxidored FAD_binding_2 DAO_C FAD_binding_3 NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like 3HCDH_N Pyr_redox GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJB56692
UniProt: W9BAV9
LinkDB All DBs
Position
complement(1546240..1547862)
Genome map
AA seq 540 aa AA seqDB search
MTGRLDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNHGLLHSGARYAV
TDNESARECISENRILRRIARHCIEPTNGLFITLPEDDLAWQQTFIDACQQAGIEATPLS
PQEALRREPAVNPTLLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRRGD
RVCGVQVYDRQLHQARTLYAGMVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRINN
LVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAAEVDTLLREGEKLAPVM
GRTRILRAYSGVRPLVASDNDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTTPCTTAEAPLPGSQEPTESTLQKIISLPTPLRGSAVYRHGDRTPSW
LGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAAGL
LQRFNVTTPAQSLTQLSEFLNERWKGVQPIAWGDALRESEFTRWVYLGLCGLPQEHRDEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacgtcttgatagcgaggtcattatcatcggcggcggagcaaccggcgccggt
atcgcccgcgactgcgcccggcgcggattacgaacgctgctcattgagcgccatgatatc
gccaccggggcgaccggccggaatcatggactgctgcacagcggcgcccgctacgcggtg
accgacaacgaatccgcccgcgaatgcatcagtgagaaccgcattctgcgccgcatcgcc
cgccactgtattgaaccgaccaatgggctgtttatcaccctgcctgaagatgacctggca
tggcagcaaacctttatcgacgcctgtcagcaggctggcatagaggccacgccgctctcg
ccgcaggaagcgctgcgccgggagcccgccgtcaacccgacgctgctgggcgcggtgcag
gtcccggacggtaccatcgacccgtttcgcctcaccgcggccaatatgctcgacgcccgc
gaacacggcgcgcagatccttaccggctgcgaagtaacaggcctgctgcgccggggcgat
cgcgtctgcggcgtccaggtatacgaccgccaacttcaccaggcccgcactctgtacgcc
gggatggtggttaacgccgccgggatctgggggcagcgtattgcggaatatgccgacctg
cgcatcaccatgttcccggcgaagggatcgctgctgatcctcgatcatcggattaacaac
ctggtgatcaaccgctgccgtaagccggccgacgccgatattctggtgcccggcgatacc
atctcgctgatcggcactacctcaatgcatattccttatgacgaaattgacgacaaccgg
gtaacagcggcggaggtcgataccctgctccgcgaaggggaaaagctggcgccggtcatg
ggccgcacccggatcctccgcgcctactccggcgtccgcccgctggtggccagcgataac
gatcccagcgggcgcagcgtcagccgcggcatcgtcctgctcgaccatgcccagcgtgac
ggtatggaaggcttcattaccatcaccggcggcaagctgatgacctatcgcctgatggcc
gagtgggccaccgacgccgtctgtcgtaagctgggaaacaccaccccctgtaccacggcc
gaagccccgctgcccggttcacaggagccaacggaaagtaccctgcaaaagattatctcc
ctccccaccccgctgcgcggctcggccgtctaccgtcacggcgatcgcaccccgtcctgg
cttggcgacagccgccagcaccgtagcctggtctgcgaatgtgaagccgtcactgccggt
gaagtgaaatacgcggtggaaaacctggcggtcaacaccctgctcgacctgcgccgccgc
acccggattggcatggggacctgtcagggggaactctgcgcctgccgcgctgccggcctg
ctgcagcgctttaacgtcaccacgcccgcgcagtcgttaacccagctctcggaatttctc
aatgaacgctggaagggcgtgcagcccatcgcctggggcgatgcgctgcgcgaaagcgaa
ttcacccgctgggtctacctcggcctgtgcggattgccacaggagcaccgggatgaagtt
tga

DBGET integrated database retrieval system