KEGG   Klebsiella pneumoniae 32192: KU54_011015
Entry
KU54_011015       CDS       T03746                                 

Definition
(GenBank) gluconate 2-dehydrogenase
  KO
K06152  gluconate 2-dehydrogenase gamma chain [EC:1.1.99.3]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00030  Pentose phosphate pathway
kpne01100  Metabolic pathways
kpne01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KU54_011015
Enzymes [BR:kpne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.3  gluconate 2-dehydrogenase (acceptor)
     KU54_011015
SSDB
Motif
Pfam: Gluconate_2-dh3 Peptidase_C69
Other DBs
NCBI-ProteinID: AJB57281
UniProt: A0A2D2EGF3
LinkDB
Position
2211734..2212486
AA seq 250 aa
MSSEKTNNSRRDFLVKSMALIPTVVIGGAGAGAIGVATSATAQAAPASEPASGNTATASD
WKPQFFNDREWAFINAAVARLIPADELGPGAKEAGVPEFIDRQLNTPYATGSIWYMQGPF
NPDVPKEMGYQLPLVPKQIYNLGIADAEAWCQDKYHKTFAELSSEQQDEALGLWESGKAE
FKQLPASLFFTYLLQNTREGFFSDPIHGGNKGMVGWTLINFPGARADFMDWVERGERYPF
PPVSINGERA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtcgagcgagaaaaccaacaattccaggcgtgatttcctggttaaatcgatggcgctg
atcccgacggtggtgatcggcggcgcgggagcaggggctattggcgtggccaccagcgcg
accgcgcaggcggcccccgcttcagagccagcctccgggaacaccgcgacggccagcgac
tggaagccgcagttcttcaacgatcgtgagtgggcgtttatcaacgccgccgtcgctcgc
ttaatcccggcggatgaactcggtcccggcgccaaagaggccggcgtcccggagtttatc
gaccgccagctcaataccccttacgccaccggctccatctggtatatgcaggggcccttc
aatcccgacgtgccgaaagagatgggttatcagctgccgctggtgcccaaacagatctat
aacctcgggatcgccgacgccgaggcgtggtgtcaggacaaatatcataaaaccttcgct
gaactgagcagcgagcagcaggacgaggcgctcggcctgtgggaatcgggtaaagccgag
ttcaaacagctgccggcctcgctgttcttcacctatctgctgcaaaacacccgcgaaggg
ttcttcagcgacccgatccatggcggcaataaaggcatggtcggctggacgctgattaat
tttcccggcgcgcgcgccgactttatggactgggttgaacggggcgaacgctaccccttc
ccgccggtatcaattaatggggagagggcgtaa

DBGET integrated database retrieval system