KEGG   Klebsiella pneumoniae 32192: KU54_015740Help
Entry
KU54_015740       CDS       T03746                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
kpne  Klebsiella pneumoniae 32192
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AJB58161
UniProt: A0A086I5V2
LinkDB All DBs
Position
complement(3113660..3114703)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMGTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLAMAGKLGATTVINGAKEDTVARCQQFSGDIGADI
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaaccccgggtacgatgaaaattattgccgccgat
atcccggtacccaaagagcatgaagtgctgatcaaagttgaatacgttggtatttgcggt
tcagatgttcacgggtttgaatcgggcccttttattccgccgaaagacccaaaccaggaa
attggtctcgggcatgaatgtgccggtacggtggtggcggtgggaagtcgcgtcagtaaa
tttaaaccgggcgaccgggtgaacattgaacccggcgtgccgtgcggccactgccgctac
tgtctggaggggaaatacaacatctgccctgatgtcgactttatggccacgcagcctaac
tatcgcggcgcgctaacccactatctatgccatccggaaagcttcacttacaagctaccc
gataacatgggcaccatggaaggcgcgctggtagagcctgcggcggtagggatgcatgcc
gcaatgctggctgacgtgaagcctggcaagaaaatcgtcatcctgggggccggctgtatt
ggcttaatgaccctgcaagcctgtaagtgtttaggggcaaccgacatcgccgttgtcgat
gttctggaaaagcgtctggccatggccgggaagcttggggcgacgaccgtcatcaacggt
gcgaaagaggacaccgtcgcccgctgtcagcaattctccggcgatatcggggcagacatt
gtttttgaaacggccggctcggcgatcaccgtgaagcaggctccgtatctggtgatgcgc
ggcgggaaaatcatgatcgttggtacggttcccggagattcggcgattaattttctcaaa
attaaccgtgaagtctcaattcagaccgttttccgctatgccaaccgctatccggtcacc
attgaagccatttcctccgggcgtttcgatgtcaagtcgatggtgacgcatatttatgat
tatgaagatgttcagcgcgcgtttgacgagtccgttaacaacaaacgcgaaattatcaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system