KEGG   Klebsiella pneumoniae 32192: KU54_015740
Entry
KU54_015740       CDS       T03746                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
kpne  Klebsiella pneumoniae 32192
Pathway
kpne00040  Pentose and glucuronate interconversions
kpne00051  Fructose and mannose metabolism
kpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KU54_015740
   00051 Fructose and mannose metabolism
    KU54_015740
Enzymes [BR:kpne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     KU54_015740
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 ThiF
Other DBs
NCBI-ProteinID: AJB58161
LinkDB
Position
complement(3113660..3114703)
AA seq 347 aa
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMGTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLAMAGKLGATTVINGAKEDTVARCQQFSGDIGADI
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaaccccgggtacgatgaaaattattgccgccgat
atcccggtacccaaagagcatgaagtgctgatcaaagttgaatacgttggtatttgcggt
tcagatgttcacgggtttgaatcgggcccttttattccgccgaaagacccaaaccaggaa
attggtctcgggcatgaatgtgccggtacggtggtggcggtgggaagtcgcgtcagtaaa
tttaaaccgggcgaccgggtgaacattgaacccggcgtgccgtgcggccactgccgctac
tgtctggaggggaaatacaacatctgccctgatgtcgactttatggccacgcagcctaac
tatcgcggcgcgctaacccactatctatgccatccggaaagcttcacttacaagctaccc
gataacatgggcaccatggaaggcgcgctggtagagcctgcggcggtagggatgcatgcc
gcaatgctggctgacgtgaagcctggcaagaaaatcgtcatcctgggggccggctgtatt
ggcttaatgaccctgcaagcctgtaagtgtttaggggcaaccgacatcgccgttgtcgat
gttctggaaaagcgtctggccatggccgggaagcttggggcgacgaccgtcatcaacggt
gcgaaagaggacaccgtcgcccgctgtcagcaattctccggcgatatcggggcagacatt
gtttttgaaacggccggctcggcgatcaccgtgaagcaggctccgtatctggtgatgcgc
ggcgggaaaatcatgatcgttggtacggttcccggagattcggcgattaattttctcaaa
attaaccgtgaagtctcaattcagaccgttttccgctatgccaaccgctatccggtcacc
attgaagccatttcctccgggcgtttcgatgtcaagtcgatggtgacgcatatttatgat
tatgaagatgttcagcgcgcgtttgacgagtccgttaacaacaaacgcgaaattatcaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system