KEGG   Klebsiella pneumoniae 32192: KU54_019020Help
Entry
KU54_019020       CDS       T03746                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kpne  Klebsiella pneumoniae 32192
Brite
KEGG Orthology (KO) [BR:kpne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KU54_019020
Enzymes [BR:kpne01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KU54_019020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 Glutaredoxin DAO FMO-like NAD_binding_9 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJB58763
UniProt: A0A060VFM4
LinkDB All DBs
Position
complement(3750762..3752327)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHIALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaagctgaccaagcct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagtcacctttaaagaagacaacacgctcgcggta
cgtaagccctcgttcctgattactaacccaggttccgaccaggggccgcgttttgcgggc
tcgccgctgggccacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcccagtcgctgctggagcagatccgcgatattgatggcgatttcgaa
ttcgaaacctactattcgctctcctgtcataactgcccggacgtggtccaggccctgaac
ctgatggcggtgctcaacccgcgcatcaaacacacggcgattgacggcgggaccttccag
aatgagatcaccgagcgtaacgtcatgggcgtgccagcggtgttcatgaacggtcaggag
tttggtcagggacggatgacgctgactgaaatcgtcgccaaagtggataccggtgcggaa
aaacgcgcagcggaagagctgaatcagcgtgacgcttacgatgtactgatcgttggctcc
ggcccgtccggcgcggcggcggcggtctactctgcacgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatttcg
gtgccgaaaaccgaaggccagaagctggcaggcgcgctgaaagcgcacgtcaatgactat
aacgtcgacgtgatcgactcccagagtgcgaccaaactgacgccggcggcgacagagggc
ggcctgcatcagatcgaaaccgcctccggcgcggtgctcaaggcgcgtagcgtcatcatc
gccaccggggcgaaatggcgcaatatgaacgtgccgggcgaagatcagtatcgcaccaag
ggcgtgacctactgccctcactgcgatggtccgctgtttaagggcaaacgcgtagcggta
atcggcggcgggaactccggcgtggaagccgccattgacctggcgggcgtcgtagagcac
gtaaccctgctggagtttgccccagagatgaaagccgaccaggtgttgcaggataaagtc
cgcagcctgaagaatgtcgacatcattcttaatgcgcagaccacggaagtgaaaggcgat
ggcagcaaagtcaccggcctgcagtatcgtgaccgggtgagcggcgatgagcatcatatc
gcgctggcggggatcttcgtccagattggcctgctgcctaacaccacctggctggaaggc
gccgttgagcgcaaccgcatgggtgagatcatcatcgatgcgaagtgcgaaaccaacgtc
aaaggcgtgttcgccgcgggcgattgcaccaccgtgccgtacaaacagattattatcgcg
gcaggggaaggggcaaaagcgtcgctgagcgctttcgactacctgatccgcacgaaaacc
gcataa

DBGET integrated database retrieval system