KEGG   Klebsiella pneumoniae Kp52.145: BN49_0913Help
Entry
BN49_0913         CDS       T05281                                 

Gene name
cbiT
Definition
(GenBank) highly similar to probable cobalt-precorrin-6Y C(15)-methyltransferase [decarboxylating] from Salmonella typhimurium (sp|Q05632)
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00860  Porphyrin and chlorophyll metabolism
kpnk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN49_0913 (cbiT)
Enzymes [BR:kpnk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     BN49_0913 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PCMT Methyltransf_31 Cons_hypoth95 GidB PrmA Methyltransf_4 Methyltransf_25 Methyltransf_18 Methyltransf_12 Methyltr_RsmB-F Met_10 Methyltransf_11 CMAS Methyltransf_23 UPF0020 Methyltransf_2 RrnaAD DOT1
Motif
Other DBs
NCBI-ProteinID: CDO12674
UniProt: A0A0W8ARX3
LinkDB All DBs
Position
938718..939287
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGAQVPMTKEAVRALALAKLELHRARHLIDIGAGTGSVSIEAALQNPALRVTA
IERQADALRLLAENRQRFGCDNIAIVAGVAPLAVADKADAIFMGGSGGHLTALIDWSLAQ
LHPGGRLVMTFILQENLHSALAHLRQSGIHEVDCQQLAVSTLATLGSGHYFKPHNPVFVI
ACQKEENHG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctgtttttgcgcggcgcccaggtgccgatgaccaaagaggccgtgcgc
gcgctggcgctggcgaagctggagctgcaccgggcgcgccatctgattgatatcggcgcg
ggcaccggcagcgtcagcattgaggctgctctacagaacccggcgctgcgggtgacggcg
attgagcgtcaggccgacgcgctgcgcctgctggcggagaaccggcagcgctttggctgc
gacaacatcgctatcgtggcgggcgttgcgccgctggcggtcgccgacaaagccgacgcg
atctttatggggggcagcggcggccacctgacggcgctgatcgactggtcgctggcgcag
ctgcatcccggcggccggctggtgatgacttttattttgcaggaaaaccttcatagcgcc
ctggcgcacctgcggcagagcggcatccacgaggtggactgccagcagctggcggtctcc
accctggctaccctgggcagcggccactacttcaaaccccataatcccgtttttgtcatc
gcctgtcagaaggaagaaaaccatggttga

DBGET integrated database retrieval system