KEGG   Klebsiella pneumoniae Kp52.145: BN49_1035
Entry
BN49_1035         CDS       T05281                                 

Definition
(GenBank) unnamed protein product; highly similar to type VI secretion system effector, Hcp1 family from Enterobacter cloacae (tr|D6DXJ8)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BN49_1035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpnk02044]
    BN49_1035
Secretion system [BR:kpnk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN49_1035
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CDO12796
UniProt: W9BDS6
LinkDB
Position
complement(1070950..1071432)
AA seq 160 aa
MAIPGNMWIYDDGGALIKGGCDVADREFSIEFKGFHHNLSIPTDNATGKPTGTRQHSPMI
IVKEFDYSSPYLYKAVATGQNLKSAEIKWYKISDAGQEVEYFNMLLEGVRIVSISPTMAS
PEDKNNNHLESVELRYEKITWKHCDGNIIFTDAWNERQTA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattccaggtaatatgtggatatacgacgacggtggggcactaatcaaaggtggt
tgtgatgttgcagacagggagttcagcatcgaatttaaagggtttcatcacaatctctcc
attcccactgataatgccactggcaagcctaccggcactcgtcagcactcaccaatgatc
atcgttaaagaattcgactattccagtccatacctctacaaagcagtagctactggtcag
aacctgaaatctgctgaaatcaaatggtataaaatcagcgatgctggtcaagaagtggaa
tacttcaatatgctacttgaaggcgtccgaatcgtatcaatatctcctacaatggcttcc
ccagaagacaagaacaacaaccatcttgaatctgtcgaacttagatatgagaagatcacc
tggaaacattgtgacggaaatataattttcaccgatgcctggaatgaaagacaaacagca
taa

DBGET integrated database retrieval system