KEGG   Klebsiella pneumoniae Kp52.145: BN49_1934Help
Entry
BN49_1934         CDS       T05281                                 

Definition
(GenBank) unnamed protein product; highly similar to putative bacteriophage integrase from Salmonella typhi
Organism
kpnk  Klebsiella pneumoniae Kp52.145
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Pro_3_hydrox_C Integrase_1 Phage_integr_3
Motif
Other DBs
NCBI-ProteinID: CDO13690
UniProt: W9BNT1
LinkDB All DBs
Position
complement(2011880..2012932)
Genome map
AA seq 350 aa AA seqDB search
MAVRKLTTGKWLCECYPAGRSGRRVRKQFATKGEALAFERHTMEETEAKPWLGESVDRRT
LKDVVELWFKLHGKSLTAGQHVYDKLLLMVDALGNPIATDLTSKMFAHYRDKRLTGEIYF
SEKWKKGASPVTINLEQSYLSSVFSELSRLGEWSYPNPLENMRKFTIAEKEMAWLTHEQI
VELLADCKRQDPILALVVKICLSTGARWREAVNLTRSQVTKYRITFVRTKGKKNRSIPIS
KELYEEIMALDGFNFFTDCYFQFLSVMGKTSIVLPRGQLTHVLRHTFAAHFMMSGGNILA
LQKILGHHDIKMTMRYAHLAPDHLETALRFNPLATLPSGDKVAAAVGITP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcagtacgaaaactcaccacaggaaaatggctttgcgaatgttaccctgccggacgt
agtggacgtcgtgtgcgtaaacaattcgccaccaaaggcgaagctctggcttttgagcgt
cacacgatggaagaaaccgaagcaaaaccctggctgggtgaatcagtggatcgtcgaaca
ctgaaagacgtggttgagctatggttcaaactacatggtaaatctctgacagctgggcag
catgtctatgacaaattgctgttgatggttgacgctctgggaaatcccattgcaaccgat
ctcacctctaaaatgtttgcccactatcgagataaacgcctgacaggagagatctacttc
agcgaaaaatggaagaaaggagcaagcccggtcaccattaacctggagcaaagctatctt
agtagtgtttttagcgaactatcccgcctgggcgaatggtcgtatccgaacccactggag
aacatgcgaaaattcaccatcgcagaaaaagagatggcatggcttacccatgagcagatt
gttgaattactggctgattgcaaacgtcaggacccaattctggcactggtagttaagata
tgcttaagcacaggcgcacgctggcgtgaagctgtaaatcttacccgctcacaggtgacc
aaataccgaattacctttgtaagaacgaaggggaagaaaaacagaagcatccctatcagt
aaagaactttacgaagagatcatggcgcttgatgggttcaatttcttcacagactgctat
tttcaatttttatctgtgatgggaaaaacgtctatcgtgctccctcgcggtcaactgaca
cacgttctgcgccatacgtttgcggcgcatttcatgatgtcgggtggaaatatccttgct
ttgcaaaaaatcctcggacatcacgacataaaaatgactatgcgttacgcacatctggca
ccggatcatctggaaacggcgctccgtttcaatcctctggcaacgctgccaagtggcgac
aaagtggcggcagcggttggcattaccccgtaa

DBGET integrated database retrieval system