KEGG   Klebsiella pneumoniae Kp52.145: BN49_2420Help
Entry
BN49_2420         CDS       T05281                                 

Gene name
rnb
Definition
(GenBank) highly similar to exoribonuclease 2 from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp|A6T7Z4)
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpnk03016]
    BN49_2420 (rnb)
Enzymes [BR:kpnk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BN49_2420 (rnb)
Transfer RNA biogenesis [BR:kpnk03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BN49_2420 (rnb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2 PilZ
Motif
Other DBs
NCBI-ProteinID: CDO14176
UniProt: W9BP28
LinkDB All DBs
Position
complement(2518872..2520806)
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRAEGVVKGTEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
VAVIHSEKERESAEPESLVEPFLTRFVGKVQKKDDRLAIVPDHPLLKDAIPCRAARGVEH
DFKQGDWAVAEMRRHPLKGDRGFYAELTQFITFSDDHFVPWWVTLARHNLEKEAPDGVAT
EMLDEGLTRRDLTALDFVTIDSASTEDMDDALYAESTADGKLLLTVAIADPTAWIAEGSK
LDNAAKVRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLAADGTIEDNIEF
FAATIESKAKLAYDDVSDWLEGRGSWQPDSEAIAQQITLLKDVCQRRSEWRQTHALVFKD
RPDYRFVLGEKGEVLDIVAEPRRIANRIVEESMIAANICAARVLRDKLGFGVYNVHTGFD
PANTEQLAALLKTHDVHVDPTEVLTLEGFCKLRRELDAQPTGFLDSRIRRFQSFAEISTE
PGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAIIKGETIARPQDEATVQMAERRRLNRM
AERDVADWLYARFLNDKAGTDTRFAAEIIDVSRGGMRVRLVDNGAVAFIPAPFLHAVRDE
LVCSQENGTVQIKGEVVYKVTDVIDVTIAEVRMETRSIIARPAV
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggataacccgctgctagcgcagcttaaacagcaactgcattcccagacgccg
cgcgcggaaggggtcgttaagggcacggaaaagggctttggcttcctcgaagtggacgct
cagaagagctacttcattccgccgccgcagatgaaaaaagtgatgcatggcgaccgtatc
gtcgcggtgatccattctgaaaaagaacgcgaaagcgccgagccggaatcgctggttgag
cccttcctgactcgttttgtcggtaaagtccagaagaaagacgatcgcctcgctatcgtt
cctgaccatccgctgctgaaagacgccattccctgccgcgccgcccgcggcgttgagcac
gattttaaacagggtgactgggccgtcgccgagatgcgccgtcatccattaaaaggcgac
cgcggattttacgcggagttgacccagttcatcacttttagcgacgaccacttcgtccca
tggtgggtaaccctggcgcgccataatcttgagaaagaggcaccggacggcgtcgccacc
gagatgctcgacgaggggctgacgcgccgcgacctaaccgccctcgacttcgtcaccatt
gacagcgccagcaccgaagatatggacgatgcgttgtatgccgagtccactgctgatggc
aaactgctgctgacggtcgccattgccgacccgaccgcctggattgccgaaggcagcaag
ctggataacgccgcaaaagtgcgcgcctttaccaactatctgccgggcttcaacattcca
atgctgccgcgcgagctgtcagacgatctctgctccctgcgcgctaacgaagtgcgcccg
gtgctggcctgccggatgaccctggcggccgatggcaccatcgaagacaatatcgagttc
tttgccgccaccatcgaatcgaaagccaagctggcctatgacgacgtctctgactggctg
gaaggccgcggcagctggcagccggacagcgaggcgatcgcgcagcaaattacgctgctg
aaggacgtgtgccagcgtcgtagcgaatggcgtcagacccatgcgctggtgttcaaagac
cgtccggactaccgttttgttctcggcgaaaaaggcgaagtgctggatatcgtcgcggaa
ccgcgtcgcattgccaaccgcattgtcgaagagtcgatgatcgccgccaacatctgtgcc
gcccgcgttctgcgcgacaagctcggcttcggcgtttataacgttcataccggtttcgac
ccggcgaacaccgagcagttggccgccctgctgaaaacccatgatgtgcacgtcgacccg
acggaagtgctcaccctggaagggttctgcaagctgcgccgggaactggacgctcagccg
accggtttcctcgacagccgcattcgccgcttccagtcgtttgcggaaatcagcaccgag
ccgggcccgcactttggtcttgggcttgaagcctatgccacctggacctcgccgatccgt
aagtatggcgacatgatcaaccaccgtctgctgaaagccatcattaaaggcgagaccatt
gcgcgtccccaggatgaagccaccgtgcagatggcggagcgccgtcgtctcaaccggatg
gccgagcgcgacgtcgccgactggctgtacgcccgtttcctcaacgataaagccgggacc
gatacccgcttcgcggcggagatcatcgacgtcagccgcggcgggatgcgcgtgcgtctg
gtggacaatggcgcggtcgcctttattccggccccgttcctccacgccgtgcgcgacgaa
ctggtgtgcagccaggagaacggtaccgtgcagatcaaaggtgaagtagtctataaagtg
actgacgttatcgatgtcactatcgctgaagttcgcatggaaacccgcagcattattgcg
cgtccggcggtctga

DBGET integrated database retrieval system