KEGG   Klebsiella pneumoniae Kp52.145: BN49_4482Help
Entry
BN49_4482         CDS       T05281                                 

Gene name
ef-tu
Definition
(GenBank) highly similar to elongation factor Tu from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp|A6TEX7)
  KO
K02358  elongation factor Tu
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kpnk03012]
    BN49_4482 (ef-tu)
   03029 Mitochondrial biogenesis [BR:kpnk03029]
    BN49_4482 (ef-tu)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpnk04147]
    BN49_4482 (ef-tu)
Translation factors [BR:kpnk03012]
 Eukaryotic Type
  Elongation factors
   BN49_4482 (ef-tu)
 Prokaryotic Type
   BN49_4482 (ef-tu)
Mitochondrial biogenesis [BR:kpnk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BN49_4482 (ef-tu)
Exosome [BR:kpnk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BN49_4482 (ef-tu)
  Exosomal proteins of breast cancer cells
   BN49_4482 (ef-tu)
  Exosomal proteins of colorectal cancer cells
   BN49_4482 (ef-tu)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: CDO16225
UniProt: A0A0N7GUR2
LinkDB All DBs
Position
complement(4768324..4769508)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIN
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgtactggctaaaacctac
ggtggttccgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggccacttggatacctatatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtaggt
gaagaagttgaaatcgttggtatcaaagaaaccgcgaaaaccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaac
ccgcacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggtcgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system