KEGG   Klebsiella pneumoniae 34618: LI86_01480Help
Entry
LI86_01480        CDS       T03747                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00250  Alanine, aspartate and glutamate metabolism
kpnu00410  beta-Alanine metabolism
kpnu00640  Propanoate metabolism
kpnu00650  Butanoate metabolism
kpnu01100  Metabolic pathways
kpnu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LI86_01480
   00650 Butanoate metabolism
    LI86_01480
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI86_01480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI86_01480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpnu01007]
    LI86_01480
Enzymes [BR:kpnu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LI86_01480
Amino acid related enzymes [BR:kpnu01007]
 Aminotransferase (transaminase)
  Class III
   LI86_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJB73952
UniProt: W9BMV5
LinkDB All DBs
Position
312972..314237
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgccatccgaaa
gtggtcgccgcggttgccgaccagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatc
gcccgcgcttacaccggtcgtccggggctgattaccttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggcca
ttcccgggctcggtgtatcacggcgtttaccccaatgcggcgcatggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggaccaggtagcg
gccatcattctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggc
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtgattgccgaagagcagctgtgt
cagcgcgctgaacagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgtagatgtccgcggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaacaggcgaaccgtcgccggaattcacccgccttgtgcaacagaaagcgcaggag
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatccccgacgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system