KEGG   Klebsiella pneumoniae 34618: LI86_02975
Entry
LI86_02975        CDS       T03747                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00052  Galactose metabolism
kpnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI86_02975
Enzymes [BR:kpnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     LI86_02975
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_25 2-Hacid_dh_C Methyltransf_31 MTS UDPG_MGDP_dh_N 3HCDH_N Methyltransf_24 PrmA CoA_binding Methyltransf_11 Pyr_redox_2 ELFV_dehydrog Shikimate_DH Pyr_redox Met_10
Other DBs
NCBI-ProteinID: AJB74232
UniProt: A0A086IV02
LinkDB
Position
complement(588375..589418)
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATHVFNSREMSGQAIQQALESIQFDQLVLETAGTP
QTVALAIEAAGPRAQLALVGTLHHDLTLLAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFARAVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatcccc
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccgggttatgcggctcc
gatatcccgcgcattttcgccaaaggggcgcattactaccctattacgctggggcacgaa
ttcagcggttatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccttgcttccagtgcccgcaatgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgcgccaacctgttccgcctgccggaccagatgccaattgatgatggc
gcgtttatcgaaccgataaccgttggcctgcacgcttttcatctggcgcagggctgtgaa
ggtaaaaacgtgattattatcggcgccggcaccatcggcctgctggcgctacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaagctggagctg
gccaaaaccctcggcgcaacccatgtgttcaacagtcgcgagatgagcggccaggcgatt
cagcaggcgctggaatccattcagttcgaccagttagtcctcgagaccgccggtacgccg
cagaccgtcgcgctggcgattgaggccgccggtccgcgggcgcagctggcgttggttggc
acgcttcatcacgatttaaccctcctggcagccaccttcgggcagattctgcgtaaggag
ttgaatattgtgggtagctggatgaactactctggcccgtggccgggagaagagtggcaa
acggccacccgtctgctgactgaaaaacgcctgcagctggcgccgctgatcgcccatcgt
ggcgacgcagaaagcttcgctcgtgcagtgcaggcgctcaacggcgcgccaatgcaaggc
aaaatcctgctcaaactctcttga

DBGET integrated database retrieval system