KEGG   Klebsiella pneumoniae 34618: LI86_14615
Entry
LI86_14615        CDS       T03747                                 

Definition
(GenBank) type VI secretion protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
kpnu  Klebsiella pneumoniae 34618
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpnu02044]
    LI86_14615
Secretion system [BR:kpnu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LI86_14615
SSDB
Motif
Pfam: T6SS_VasE CortBP2
Other DBs
NCBI-ProteinID: AJB78784
UniProt: A0A2U0M9G9
LinkDB
Position
complement(2919893..2921233)
AA seq 446 aa
MKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQ
AHRLQVRFQDGTMIDTDNADALPSALSLDGAPGEAVIVLALPLMQANGGNCLKPEEVAER
PVRFRQRWRDVRNQFGDDTRQIAVIQPELTLRFAHQDNSDYLTCPLVRLQRDSQGAWLID
ETFLSPLLQIQGSRWLATQLEQLLVQLRARLTRLMAMRRESNERMADFAVADVSLFWLLN
ALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSLTHQANAVPIYQHDQLNAVFPP
LFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLSVRSSVPVAQLQ
EQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QSGTCMFYVPGMLGEPELELFAVLRT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaaacggaacgtccgttgtggggccggggcattatggtgtcgcctcagcattttcaa
cagcaggctgcgtatgcagcctggactgcggaagtgattgcccggatgggtcttaaccac
ccctggggagtggttgaggcaaccttcgaaccagagatgctcaaactgggccgcctgcag
gctcacaggctgcaggtccggttccaggatggcacgatgattgatacggacaatgccgat
gcgctgccgtccgcgctgtcgctggacggcgcgcccggcgaggcggtgatcgtgctggcg
ctgcccctgatgcaggcgaatggcggcaactgtctgaagccggaggaggttgccgaaagg
ccggtgcgcttccggcagcgctggcgcgatgtccgtaaccagtttggggatgatacccgg
cagattgccgtcatacagccggagctgaccctccgcttcgcccaccaggacaacagcgat
tacctgacctgtccgcttgttcgcctgcagcgggactcgcagggggcctggcttatcgac
gagacgtttctctcgccgctgctgcagatccagggcagccgctggctggcgacgcagctt
gaacagctgctcgtccagctccgggctcgtctgacgcgcctgatggccatgcgtcgcgaa
agcaatgaacggatggctgattttgccgtagccgatgtctctctgttctggttgctgaat
gcgctgaacagcgccgaaccggtgctggggtactttctgcgttaccggcaaagcccgccg
gaacgcctctacccggagctggcgcgcctggctggtagcctgctgaccttttcgctcacc
catcaggcgaatgccgtcccgatctatcagcatgaccagctgaacgcggtttttccgccg
ctgtttgatttactgagcgacctgctggaggcgagcctgccatcgcgggtggtggcgatt
gccctggagcatgatgtccggctgcacttctggcaggcgcgtctgcacgatgcccggctg
cgggaaggggctgattactacctgtcggttcgttcgtcggtaccggtcgcccaactgcag
gagcagtttccgcgccagtgcaaagtgggcagtccggatcatgtcaaagccatcgtcaac
tcctcgcggacaggggtgcccctcacgccattgcgtcatgtgccggcggcgatcccgctg
cgtctggaaaatcagtatttcagcctcgatgtgtcccaccctctggcaacggaaatgctg
cagagcggcacctgtatgttttacgtcccggggatgctcggtgagcctgaacttgaactt
tttgcggtactacgaacgtga

DBGET integrated database retrieval system