KEGG   Klebsiella pneumoniae 34618: LI86_24190Help
Entry
LI86_24190        CDS       T03747                                 

Definition
(GenBank) xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00040  Pentose and glucuronate interconversions
kpnu00053  Ascorbate and aldarate metabolism
kpnu01100  Metabolic pathways
kpnu01120  Microbial metabolism in diverse environments
Module
kpnu_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LI86_24190
   00053 Ascorbate and aldarate metabolism
    LI86_24190
Enzymes [BR:kpnu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     LI86_24190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Radical_SAM HTH_Tnp_1 DPRP
Motif
Other DBs
NCBI-ProteinID: AJB78213
UniProt: A0A086ID93
LinkDB All DBs
Position
complement(4802307..4803161)
Genome map
AA seq 284 aa AA seqDB search
MLAKSIPLGIYEKALPAGECWLERLKLAKALGFDFVEMSLDETDARLARLDWSPEQRLAL
VKAVAETGVRVPSMCLSAHRRFPLGSEDDAVRHQGLEIMRKAIRLAQDVGIRVIQLAGYD
VYYQQANDETRRRFRDGLKQSVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWF
QLYPDIGNLSAWDNDVQMELKAGSGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLK
QTGYCGPYLIEMWSETSADPLAEVAKARDWVKARMARAGLMEAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaaatccattccgctcggcatctatgaaaaagcgctccccgccggggagtgc
tggctggagcggctaaagcttgcaaaagcgctgggctttgatttcgttgagatgtctctc
gatgaaacggacgcccgccttgcgcggctggactggagcccggagcagcgtctggcgctg
gtcaaggcggtggctgaaaccggcgtccgggtgccgtcgatgtgccttagcgcccatcgc
cgttttccgctgggtagtgaagacgacgcggtgcggcatcaggggctggagatcatgcgt
aaagccatccgcctggcgcaggatgtggggattcgggtgatccagctggcaggctacgac
gtctattaccagcaggcgaacgatgagacgcgccgccgctttcgcgacggcctgaaacag
agcgtcgagatggccagccgagcccaggtaaccctggcgatggagatcatggactacccg
ctgatgaactcgatcagtaaagcgctgggctatgcccattacctgaataatccgtggttc
cagctttacccggatatcggcaatctgtcggcgtgggataacgacgtccagatggagctg
aaggcggggagcgggcatatcgtggcggtacacgtcaaagacacgaagcccggcgtcttt
aaaaacgtgccgttcggcgaaggggtggtcgattttgaacgctgcttcgaaacgctcaag
cagaccggctactgcggcccgtacctgattgagatgtggagcgaaaccagcgctgacccg
ctggcggaggtggcgaaggcgcgtgactgggtgaaggcgcggatggcccgcgcgggcctg
atggaggcggcataa

DBGET integrated database retrieval system