KEGG   Klebsiella pneumoniae 34618: LI86_26345Help
Entry
LI86_26345        CDS       T03747                                 

Definition
(GenBank) sulfate ABC transporter substrate-binding protein
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00630  Glyoxylate and dicarboxylate metabolism
kpnu00680  Methane metabolism
kpnu01100  Metabolic pathways
kpnu01120  Microbial metabolism in diverse environments
kpnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LI86_26345
  09102 Energy metabolism
   00680 Methane metabolism
    LI86_26345
Enzymes [BR:kpnu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     LI86_26345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdop_Fe4S4 Molybdopterin TAT_signal Rieske_3
Motif
Other DBs
NCBI-ProteinID: AJB78600
UniProt: A0A060VLS6
LinkDB All DBs
Position
5229974..5230561
Genome map
AA seq 195 aa AA seqDB search
MQVSRRQFFKICAGGMAGTTAAALGFAPATALAETRQYKLLRTRETRNTCTYCSVGCGLL
MYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHSESRLKFPEYRAPGSDK
WQQISWDEAFDRIAKLMKEDRDANFIAQNDAGTTVNRWLTTGMLCASASSNETGYLTQKF
TRALGMLAVDNQARV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcagaaggcagttctttaagatctgcgctggcggtatggcgggaaccacg
gcagcagcgctgggctttgccccggcaactgcgctcgcggagacacggcagtacaaattg
ctgcgcacgcgcgaaacccgtaacacctgcacatactgttctgtcggctgtgggctgttg
atgtatagcctcggcgacggcgcgaaaaacgccaaagcatccattttccatatcgaaggc
gatccggatcatccggtcaaccgtggtgcgctctgtccgaaaggggctggtctggtggac
tttatccattctgaaagccgcctgaaattcccggaatatcgcgcgccaggctccgataaa
tggcagcaaatcagttgggacgaagcgttcgatcgcatcgccaagctgatgaaagaggac
cgcgacgccaactttatcgcgcaaaacgacgccggcaccaccgtcaaccgctggttgact
accgggatgctgtgcgcctccgcctccagtaacgaaaccggctatttaacgcaaaaattc
acccgcgccctcgggatgctggcggtggataaccaggcgcgtgtctga

DBGET integrated database retrieval system