KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_00370Help
Entry
KPN2242_00370     CDS       T01982                                 

Definition
(GenBank) putative glutathione S transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPN2242_00370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpo02000]
    KPN2242_00370
Enzymes [BR:kpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPN2242_00370
Transporters [BR:kpo02000]
 Other Transporters
  Pores ion channels [TC:1]
   KPN2242_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AEJ96001
LinkDB All DBs
Position
80947..81615
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKTMLAPAALKKIHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQGIDDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGSLLGKGIQKTWLDPQLATHARFIDDHLAARPWFAGERLSMADIQMSFPVM
ALLARGGMHDLVHIEAWRQRVEQRPAWQRAIERGGPFTLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacatcatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggagaaaacgatgctggcgccg
gcggcgctgaaaaaaatccatccgttgggcaaatcaccggtactggaagataacggctat
gtgctggcggagtccggggcgatcctcgagtatttgcaggaaacctgggacagcggcggg
ttgttgaagccgcagggaattgacgacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagccttggcaaaccc
cctgtgccctttggcgttcgctcgctgggttcgctgctgggcaaggggatacagaaaacg
tggctcgatccgcagctggccacccatgcgcggttcattgacgaccatcttgccgcgcgg
ccatggttcgctggcgagcggctgagcatggccgatatccagatgagcttcccggtgatg
gcattgttggcgcgcggcggcatgcatgaccttgtccatatcgaggcctggcgtcagcga
gtggaacagcgaccggcctggcaacgcgccatcgagcgcggcggccccttcaccttaccc
ggcgcctga

DBGET integrated database retrieval system