KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_02280Help
Entry
KPN2242_02280     CDS       T01982                                 

Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo03030  DNA replication
kpo03430  Mismatch repair
kpo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    KPN2242_02280
   03430 Mismatch repair
    KPN2242_02280
   03440 Homologous recombination
    KPN2242_02280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:kpo03032]
    KPN2242_02280
   03400 DNA repair and recombination proteins [BR:kpo03400]
    KPN2242_02280
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     KPN2242_02280
DNA replication proteins [BR:kpo03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     KPN2242_02280
DNA repair and recombination proteins [BR:kpo03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     KPN2242_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: AEJ96376
LinkDB All DBs
Position
484856..485269
Genome map
AA seq 137 aa AA seqDB search
MTSRREWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLIGDILRA
LAVTPDQVLQLTPERVAMLPQDSRCNSWRLGTEASLPLAGAQVSTPAFDELQTSAPARRA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagaatggcaattacagcagctgggcattacccagtggtcgctgcgc
cgaccgggggcgttgcagggcgaaatcgctatctcgcttcctgaacatattcgtctggtg
atggtggcggaaaccccgccgtcgctgacagagccgctgattggcgacatattacgcgcg
ctggccgtgacgccagatcaggtcctgcagctgactccggagcgggtggcgatgctgccg
caggacagccgctgcaacagctggcggttgggcacagaggcgtcgctgccgctggcgggc
gcccaggtgtccacccccgcttttgatgaactccagaccagcgcgccggctcgcagggcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system