KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_19875Help
Entry
KPN2242_19875     CDS       T01982                                 

Definition
(GenBank) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00030  Pentose phosphate pathway
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
kpo01230  Biosynthesis of amino acids
Module
kpo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpo_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPN2242_19875
Enzymes [BR:kpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     KPN2242_19875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: AEJ99858
LinkDB All DBs
Position
complement(4186173..4186832)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGITVFDLNSVDRLGIYVDGADEINGHMQMIKGGGAALTREKIIASVADKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGLEILDAI
ALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaactgaaaaaagcggtaggttgggcagcactgcaatatgtacagcca
gggactattgtcggcgtaggcaccggctcgacggcggcccattttattgacgcgctgggc
accatgaaggggcagatcgaaggggcggtttccagctccgacgcctccaccgagaagctg
aaaagcctcgggatcaccgtcttcgatcttaacagcgtcgatcgcctggggatctatgtt
gacggcgcggatgagatcaacggccatatgcagatgatcaaaggcggcggcgcggcgctg
acccgtgaaaagatcatcgcctcggtcgcggataaatttatctgcatcgccgacgcctcc
aagcaggtcgatattctgggcaagttcccgctgccggtggaagtcattccgatggcgcgc
agcgccgtggcgcgtcagctggtcaagctgggcggccgtccagagtaccgtcagggcgtg
gtgactgataacggcaacgtgatccttgacgtgcacggcctggaaattctcgatgcgatc
gcgctggaaaacgcgatcaacggtattcctggcgtcgtcaccgtggggctgttcgccaac
cgtggcgccgacgtggcgctgattggtactgccgacggcgtgaagaccatcgtaaaatag

DBGET integrated database retrieval system