KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_21985Help
Entry
KPN2242_21985     CDS       T01982                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00564  Glycerophospholipid metabolism
kpo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPN2242_21985 (glpD)
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KPN2242_21985 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AEK00277
LinkDB All DBs
Position
4604747..4606255
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRAAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLTAE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcgtggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgcc
acctccagcgccagttccaaactgatccacggcgggctacgctacctcgaacactatgag
ttccgtctggtcagcgaagcgctggccgagcgtgaagtgctgttaaaaatggccccgcat
atcgccttcccgatgcgctttcgcctaccgcatcgcccgcatctgcgcgcggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctcccgggatcc
accgggttgcgttttggcgcagaatcggtacttaaaccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggtcgtc
cgcaaaggcggcgaagtgcgtacccgcacccgcgctatctcggcgaaacgtgagaatggc
ctgtgggtggtggaagcggaagatattgatagcggtgagaagtttacctggaaggcgcgc
ggcctggtcaatgccaccggcccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggcatccgtctgatcaagggcagccacatcgtggtgccgcgggtgcat
acccagaaacaggcttatattctgcaaaacgaagataaacgcatagtgtttgttattccg
tggatggatgagttctctatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtggccattgatgataaagagatcaactatctgctgaacgtctataacgcgcacttt
aaaaagaccctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgc
gacgacgagtcggattcgccgcaggccattacccgcgactacaccctggatattcacgat
gagaacggtcaggcgccgctgctgtccgtcttcggcggcaagctgaccacctatcgcaaa
ctggccgagcatgcactggaaaaactgaccccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatatcggcggcgaccgcgacgactacgcggca
aaactgcgccgtcgcttcccgttcatcagtgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctcggggaa
gatttcggccacgagttttatgaagccgagctgaaatatctggttgagcacgagtgggtg
cgcagcctggatgacgccatctggcgtcgaaccaaacagggtatgtggctgactgccgag
cagcaggcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgagctgtcgtta
gcgtcgtaa

DBGET integrated database retrieval system