KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_24130Help
Entry
KPN2242_24130     CDS       T01982                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Brite
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPN2242_24130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_YpjB
Motif
Other DBs
NCBI-ProteinID: AEK00698
LinkDB All DBs
Position
5072657..5073277
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVENFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccttacgcttacgatgctctggaaccgcacttcgac
aagcagacgatggagatccatcacactaaacaccaccagacctacgtgaacaatgccaac
gccgcgctggaaagcctgccggagttcgctaacctgtccgctgaagagctgattaccaag
ctggatcagctgccggctgacaaaaaaaccgtactgcgtaacaacgccggcggccacgcg
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgatttcggttccgtggagaacttcaaagcggaattcgaaaaagcc
gctgctacccgtttcggctccggctgggcgtggctggtcctgaaaggtgacaaactggcc
gttgtctccaccgccaaccaggattccccgctgatgggcgaagccatttccggcgcttcc
ggcttcccgattatcggcctggacgtctgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagccttctgggacgtagtgaactgggacgaagctgcagcg
cgttttgccgccaaaaaataa

DBGET integrated database retrieval system