KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_0257Help
Entry
A79E_0257         CDS       T02213                                 

Definition
(GenBank) Low-affinity inorganic phosphate transporter
  KO
K16322  low-affinity inorganic phosphate transporter
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpp02000]
    A79E_0257
Transporters [BR:kpp02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   A79E_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AFQ63669
LinkDB All DBs
Position
complement(283164..284660)
Genome map
AA seq 498 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVAMAALF
NFFGVLLGGLSVAYAIVHMLPTDLLLNMGSAHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVIGIFASLIISPIVGLVIAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVSFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNASGYEITRTRDAVNNVETFFQQRPELLKKATGVDQLVPSPDTNTAA
NGEFHCHPANTINALDRVKTMLTGVENYESLKPEQRGQLRRIMLCISDTTDKVAKLPDVS
ADDQRLLKKLKTDMLSTIEYAPIWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTYA
QGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMLVDGGGLQKKTVTSILMAWVLTL
PAAIILSGVLYWLSLKLI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttatttgccggtctggatttacataccggactattattattgcttgcttta
gcttttgtactgttttacgaagcgattaacggtttccatgataccgcaaacgcggtggct
acggttatctacactcgcgcaatgcgctcacagctcgctgtggcgatggcggcgctcttc
aacttcttcggcgttctgctgggcggtctcagcgtagcctatgccatcgtgcatatgctg
ccgaccgatctgctgcttaacatgggttccgcacatggcctcgccatggtgttctctatg
ctgctggcggcgatcatctggaacctcggcacctggtacttcggtcttccagcttccagt
tctcataccctgattggcgccatcatcggcattggtttaaccaatgcgctgatgaccggt
acttccgtggttgatgcgctgaatatcccgaaagtcatcggtatttttgcttcgcttatc
atctcgccgatcgtcggtctggtgatcgcgggcggcctgattttcctgctgcgtcgctac
tggagcggaaccaaaaaacgcgcgcgtatccacctaacgcccgcagagcgtgaaaagaaa
gacggtaagaaaaagccgccgttctggacccgtatcgcgctgatcctgtctgctattggc
gtgtcgttctctcacggtgctaacgatgggcagaaaggcattggcctggtgatgctggtg
ctgatcggcgtcgcgccggcgggtttcgtggtgaatatgaatgcctctggttacgaaatc
acccgtacccgcgatgcggtcaacaacgtggaaaccttcttccagcagcgtcctgaactg
ctgaaaaaagccaccggcgtcgatcagctggtgccttctccggataccaataccgcggcc
aatggcgagttccactgccatccggcgaacaccatcaacgcccttgaccgcgtcaaaacc
atgctgaccggcgttgagaactacgagtcgctaaaaccggaacagcgcggccagctgcgt
cgcatcatgctctgcatctccgacaccaccgacaaggtggcgaagctgccggatgtgagc
gctgacgaccagcgtctgctgaagaaactgaaaaccgatatgctgagcaccatcgagtac
gcgccaatctggattatcatggctgtcgcgctggcgctgggtatcggcaccatgatcggc
tggcgccgcgtggcgaccaccatcggtgagaagattggtaagaaaggcatgacctacgct
caggggatgtcggctcagatgaccgcagcggtttctatcggtctggcgagctacaccggg
atgccggtttccaccacccacgtactctcctcctcggtagcggggacgatgctggtggat
ggcggtggtctgcagaaaaagacggtgaccagcattctgatggcctgggtgctgaccctg
ccggcagcgattatcctttcaggcgtcctttactggctctccctgaaactgatttaa

DBGET integrated database retrieval system