KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_0288Help
Entry
A79E_0288         CDS       T02213                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00250  Alanine, aspartate and glutamate metabolism
kpp00410  beta-Alanine metabolism
kpp00640  Propanoate metabolism
kpp00650  Butanoate metabolism
kpp01100  Metabolic pathways
kpp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A79E_0288
   00650 Butanoate metabolism
    A79E_0288
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A79E_0288
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A79E_0288
Enzymes [BR:kpp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A79E_0288
Amino acid related enzymes [BR:kpp01007]
 Aminotransferase (transaminase)
  Class III
   A79E_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFQ63696
LinkDB All DBs
Position
317373..318638
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVAEQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRQVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgccatccgaaa
gtggtcgccgcggtagccgagcagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatc
gcccgcgcttacaccggtcgtccggggctgattaccttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggccg
ttcccgggctcggtgtatcacggtgtctacccgaatgcggcgcatggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggatcaggtcgcg
gccatcatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagcgcctggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtcattgccgaagagcagctgtgc
cagcgcgctgaacagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgttgatgtccgcggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaacaggcgaaccgtcgccggaattcacccgccaggtgcaacagaaagcgcaggag
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatcccggatgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system