KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_0562
Entry
A79E_0562         CDS       T02213                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp00052  Galactose metabolism
kpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A79E_0562
Enzymes [BR:kpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     A79E_0562
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_25 2-Hacid_dh_C Methyltransf_31 MTS UDPG_MGDP_dh_N 3HCDH_N ELFV_dehydrog Methyltransf_24 PrmA CoA_binding Pyr_redox_2 Methyltransf_11 Shikimate_DH Pyr_redox Met_10
Other DBs
NCBI-ProteinID: AFQ63950
LinkDB
Position
complement(583691..584734)
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATHVFNSREMSGQAIQQALEAIQFDQLVLETAGTP
QTVALAIEAAGPRAQLALVGTLHHDLTLPAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFARAVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatcccc
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccgggttatgcggctcc
gatatcccgcgcattttcgccaaaggggcgcattactaccctattacgctggggcacgaa
ttcagcggttatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccttgcttccagtgcccgcaatgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgcgccaacctgttccgcctgccggaccagatgccaattgatgatggc
gcgtttatagaaccgataaccgttggcctgcacgcttttcatctggcgcagggctgtgaa
ggtaaaaacgtgattattatcggcgccggcaccatcggcctgctggcgctacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaagctggagctg
gccaaaacccttggcgcaacccatgtgttcaacagtcgcgagatgagcggccaggcgatt
cagcaggcgctggaagccattcagttcgatcagttagtcctcgagaccgccggtacgccg
cagaccgtcgcgctggcgattgaggccgccggtccgcgggcgcagctggcgctggttggc
acgcttcatcatgatttaaccctcccggcagccaccttcgggcagattctgcgtaaggag
ttgaatattgtgggtagctggatgaactactctggcccgtggccgggagaagagtggcaa
acggccacccgtctgctgactgaaaaacgcctgcagctggcgccgctgatcgcccatcgt
ggcgacgcagaaagcttcgctcgtgcagtgcaggcgctcaacggcgcgccaatgcaaggc
aaaatcctgctcaaactctcttga

DBGET integrated database retrieval system