KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2843
Entry
A79E_2843         CDS       T02213                                 

Definition
(GenBank) Short-chain type dehydrogenase/reductase
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase HEAT_2 DUF1776
Other DBs
NCBI-ProteinID: AFQ66136
LinkDB
Position
complement(3006502..3007236)
AA seq 244 aa
MTGGSRGLGRATVEALAQRGVNVVLTYNAHFAEANDVVARVEAQGSRAIALPFSAGETDT
FDGFVSAFQEALTELGADRFHYLVNNAGNASGMGFLNATESEFDALYRIHVKGGFFPQPK
IIPLLADGGRIVNISSGLTRIVMANRAPYAIMKSAVETLTRYMAFELGGRGITVNCVAPG
AIATDFSGGVVRDNPQVAQAVANMTALGRPGLPEDIGPMIASLLSDDHRWVNAQRIEVSG
GMRI
NT seq 735 nt   +upstreamnt  +downstreamnt
gtgacaggcggcagccgcggcctggggcgcgcaaccgttgaagcgctggctcagcgcggc
gtgaacgtggtattgacctacaacgcgcattttgccgaggcgaacgatgtggtcgcgcgg
gttgaagctcagggctcgcgggcgatcgcgctgcccttcagcgccggcgaaaccgacacc
tttgacgggtttgtcagcgcctttcaggaggcgctgacggagctgggggccgatcggttt
cattacctggttaataatgccggcaatgccagcggcatggggtttctgaatgctaccgaa
tcggagttcgatgcgctttatcgcatccatgtgaaggggggtttttttcctcagccaaaa
attattccgctgctggcggatggcgggcgaattgtgaatatctcgtccggactgacccgt
atcgtgatggcgaaccgggcgccctatgcgatcatgaaatccgcggtggaaaccctgacc
cgttatatggcgtttgagctgggcggccgcgggatcacggtgaactgcgtagcgccgggc
gccatcgccacggatttcagcggcggggtggtgcgggataacccgcaggtcgctcaggcg
gtagcgaacatgacggcgctgggccgacctggcctgccagaggatatcgggccgatgatc
gcctcgctgttatccgatgatcatcgctgggtgaatgcccagcgcattgaggtttccggg
ggaatgcgcatctga

DBGET integrated database retrieval system