KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2848
Entry
A79E_2848         CDS       T02213                                 

Definition
(GenBank) hypothetical protein
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
SSDB
Other DBs
NCBI-ProteinID: AFQ66141
LinkDB
Position
complement(3010825..3011760)
AA seq 311 aa
MREKYMLACALWCAIAGAEGAEKNDAQPLRDKNGEPVQAGVFTSRWGRLFSGNDKVFSGA
LSFSSGLKEQWMTVPNSSDSAEQKKKYNQTLNLSLQYSPYSFWFANVTSRLPVTDTSRYT
ADFRYSFGYDDWHANTFSLVYSNYGDNHFWTSGSKRHTYFEQGAITLAYKFSLPKPMEHA
LLINKGDAIMCQAGYSWVPRYYDLESNDIRKNKNVLLGGCGYTFKQHFLCAPPRSGIRTV
VSSSRGMAIIVTVLATRAIRRDRSLCSMPTMPVPATRGMTAAAASFVKARSALSGSCRFR
RRDVGTARPDC
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcgggagaaatatatgctggcctgcgcgctatggtgcgccatcgcaggtgcggaaggc
gcagagaagaacgacgcacaaccgctgcgtgataaaaatggtgaaccggtgcaggccggc
gtgtttaccagccgctggggacggcttttttccgggaatgacaaggtgttttcgggagcg
ctgagctttagttcgggtttaaaagagcagtggatgaccgtccccaacagctcagacagc
gcagaacagaagaaaaaatataatcagactctgaatcttagcctgcaatactcgccctac
agcttctggttcgccaacgtgacatcccgtttaccggtgactgacaccagccgctatacc
gccgattttcgctatagttttggctacgacgactggcatgccaacaccttcagcctggtt
tacagtaactatggcgataaccacttctggacctcgggcagcaagcgtcacacctatttt
gagcagggggcgattaccctggcgtataagttttcgctgccgaagcccatggagcatgcg
ctgttgattaacaaaggcgacgccatcatgtgccaggcaggctacagctgggtgccgcgt
tattacgatctggagagtaacgatatccgcaaaaacaaaaatgtgctgcttggggggtgt
ggatatacctttaaacaacattttttgtgcgcgccaccgcgttctggtatccggacagta
gtcagcagcagccgtggaatggcgattatagttacagttttggctacgcgagctatacgc
cgggatcgttctctgtgcagtatgccaactatgccggtacccgctacccgaggcatgaca
gcggcagcggcaagtttcgtgaaggcacgatcagccttatctggttcttgccgatttagg
aggcgcgatgtcggcacagcacgtcctgattgttga

DBGET integrated database retrieval system