KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2895Help
Entry
A79E_2895         CDS       T02213                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp00061  Fatty acid biosynthesis
kpp00780  Biotin metabolism
kpp01100  Metabolic pathways
kpp01130  Biosynthesis of antibiotics
kpp01212  Fatty acid metabolism
Module
kpp_M00083  Fatty acid biosynthesis, elongation
kpp_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A79E_2895
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A79E_2895
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A79E_2895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpp01004]
    A79E_2895
Enzymes [BR:kpp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A79E_2895
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A79E_2895
Lipid biosynthesis proteins [BR:kpp01004]
 Fatty acid synthase
  Component type
   A79E_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AFQ66187
LinkDB All DBs
Position
3064829..3065617
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEEFAAALGSDIV
LPCDVAEDESITALFTELEKVWPKFDGFVHSIGFAPADQLDGDYVDVVTRDGFKIAHDIS
AYSFVAMAKACRGMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSNLSAGI
SGEVVHVDGGFNIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattttgatcactggcgtcgccagcaaactgtccatc
gcctacggcatcgcgcaggcaatgcaccgcgaaggcgcggaactggcattcacctatcag
aatgagaaactgaaaggtcgcgtagaagagtttgctgccgcgctgggttctgacattgtg
ctgccgtgcgacgttgctgaagatgagagcatcaccgcgctgttcaccgagctggaaaaa
gtctggccaaaattcgatggtttcgtccactcaatcggttttgccccggctgaccagtta
gacggcgactacgttgacgttgtcactcgcgacggctttaaaatcgcgcacgacatcagc
gcttacagcttcgtggcaatggccaaagcctgccgcggcatgctgaacccgggttcggct
ctgctgacgctctcctacctgggcgcagagcgcgcgatcccgaactataacgtgatgggt
ctggccaaagcctctctggaagctaacgtccgctatatggctaacgccatgggtccggaa
ggcgttcgcgtcaatgccatctctgccggtcctatccgtacgctggccgcgtccggtatt
aaagatttccgtaaaatgctggcgcactgcgaagcggtcaccccgatccgtcgcaccgtc
accattgaagatgtgggtaacagcgcagccttcctgtgctccaacctgtctgcggggatc
tccggtgaagtcgttcacgttgacggcgggttcaatatcgccgccatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system