KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_3958Help
Entry
A79E_3958         CDS       T02213                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp00730  Thiamine metabolism
kpp00790  Folate biosynthesis
kpp01100  Metabolic pathways
kpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A79E_3958
   00790 Folate biosynthesis
    A79E_3958
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A79E_3958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpp04147]
    A79E_3958
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpp00537]
    A79E_3958
Enzymes [BR:kpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A79E_3958
Exosome [BR:kpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A79E_3958
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpp00537]
 Enzymes
  A79E_3958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AFQ67201
LinkDB All DBs
Position
complement(4199073..4200488)
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEALRASLI
NKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFTETATAG
EWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKASYHGN
IDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTHDGAVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgctctgtttattgccctgattcctctactgggctcgccggttattcat
gcagaaactactgctgcgccggttctggaaaatcgcgctgcgcagggagatatcaccact
cctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctgcgcgcctcgttaatc
aataagccagctaaaaacgttattttgctgattggcgatggcatgggtgattcggaaatt
accgctgcgcgaaactatgccgagggggcgggcggtttctttaaaggaattgatgctctg
ccgttaaccgggcagtacacgcattattcgctggataaaaaaaccgggaaaccggactac
gtgaccgactcggcggcctccgccaccgcctggaccaccggcgtgaagacttataacggc
gcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctcgagctggcgaaagcg
gcggggctggccaccggcaacgtttccaccgccgagctgcaggacgccacccccgcggcg
ttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggtcaccagcgaaaaatgc
cccagcaatgcgctggaaaaagggggcaaaggctccattaccgaacagctgctgaacgcc
cgaccggatgtcaccttgggcggcggcgcgaagacctttaccgaaacggcgacggcgggc
gagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggctaccagattgtgacc
gacgcggcttctcttgccgccgcgacggaagccagtcaggataaaccgctgctgggactc
tttgccgatggcaatatgccggtacgctgggaagggccgaaggcgtcttatcacggtaat
atcgataagccgccggtgacctgtacgccaaacccgaagcgtgacgcctcggtgccgacg
ctggcgcagatgacggagaaagcgattgacctgctcagtcgcaacgagaaaggtttcttc
ctgcaagtcgaaggcgcttccatcgataagcaggaccatgcggcgaatccgtgcggccag
atcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctggaattcgcgcgaaaa
gacggtaataccctggtgatcgtcaccgccgaccatgcgcatgccagccagatcatcccg
gcggatagcaaagccccggggctgacccaggctctgaacacgcacgatggcgcggtgatg
gtgatgagctacggcaactctgaggaagagtcgatggagcacaccggcacccaactgcgc
attgcggcctacggtccgcatgcggctaacgtcgtaggcctgaccgatcagaccgacctg
ttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system