KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_4493
Entry
A79E_4493         CDS       T02213                                 

Definition
(GenBank) hypothetical protein
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
SSDB
Other DBs
NCBI-ProteinID: AFQ67704
LinkDB
Position
4766906..4768306
AA seq 466 aa
MLPAPGTDFSRQYGLTEAVMRALILVLLFFAWVCAAADDYSFRTRGAVDDLLYYQIGGGE
AVMPPPVRRSPSPLSVGIGWNADMMCGNFDIGTTVRNQLNGITDGFQQLMGNVIQSATGA
VASLPAMIIQRANPQLYDLLTNGVLQGRLDFDKSLLNCQKMAEKMTDLAADSAWFSGAKA
ENYQTLAASDSDAIRTDQKAAKEAAEKGKRWVGGEKRGGKGQPPIKVVHDATAAGWNILN
QQPATSTTSLTSSECDGELCSTWKSPEEAAGWMTRVVGEQTISVAQATDDPDARSGAQAG
IGLHPLIDEEKAKILLVLTALVNGNQKPGFDNLAKASGGSMQLTRGVVEALRDDPDAAVL
TERLAGELALARVTEQALLARRTLLAGMREPNIANVKEAQESLGKTTIQLDEELSQLKLE
LDFRQALTRNTASQILQRKQQRDQLQGQAVEVPDDSDRRLHNLNNP
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgctgcccgcgccggggacagacttttctcggcagtacgggttaacggaggcggtgatg
agagcgcttatcctggtcttactgtttttcgcctgggtttgcgcggccgccgatgactac
agcttccgcacgcgaggcgcggtcgacgacctgctttactatcagattggcggcggcgag
gccgtgatgcctccacccgttcgccgcagtccctctccgctcagcgtggggattggctgg
aacgccgatatgatgtgcggcaatttcgatatcggcaccaccgtgcgcaaccagttgaac
ggcatcaccgacggcttccagcaactgatgggcaacgtcatccagagcgccaccggcgcg
gttgccagcctgcccgcgatgattattcagcgcgccaatccgcagctttatgatctgctg
accaacggcgtgctgcaagggcggctggattttgacaaatcgctgctgaactgccagaaa
atggcggagaagatgaccgatttagcggccgattccgcctggttttcgggagccaaagcg
gagaactaccagacccttgccgccagcgacagcgacgccatccgcaccgaccagaaagcg
gcaaaagaggccgccgaaaagggtaaacgctgggtgggcggcgaaaagcgcggcggtaaa
ggccagccgccgattaaggtagtccatgacgccaccgccgcaggctggaatatcctcaac
cagcagcccgccaccagcaccacgtctcttacctcctctgaatgcgacggggaactttgt
agcacctggaaatctcctgaagaggccgccggatggatgacccgcgtggttggcgagcag
accatcagcgtggcgcaggccaccgacgatccggatgcgcgttccggcgcacaggcgggg
atcggcctgcatccgctgatcgacgaagaaaaggcgaagatcctgcttgtgctgacggct
ctggttaacggtaaccagaagcccggcttcgacaacctggcgaaagcctccggcggatcc
atgcagcttacccgcggcgtggtcgaggcgctgcgcgacgatccggacgccgccgtcctc
accgaacggctggcgggagaactggcgctggcccgcgtcaccgaacaggcgctgctggcc
cggcgcacgctgcttgcaggtatgcgcgaaccgaatatcgccaacgtcaaagaggcgcag
gagagcctgggcaaaaccaccatccaactggatgaagagctgagccagcttaagctggaa
ctcgatttccgccaggcgctgacgcgcaataccgcgagccagatcctgcaacgcaaacag
cagcgtgaccagcttcagggacaggcggtggaagtgccggacgacagcgaccgccgcctg
cacaatctcaataatccgtag

DBGET integrated database retrieval system