KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_01615Help
Entry
KPR0928_01615     CDS       T03371                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Pathway
kpq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPR0928_01615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpq02000]
    KPR0928_01615
Enzymes [BR:kpq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPR0928_01615
Transporters [BR:kpq02000]
 Other Transporters
  Pores ion channels [TC:1]
   KPR0928_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIE26373
LinkDB All DBs
Position
343463..344131
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKTMLAPAALKKIHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQGIDDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGSLLGKGIQKTWLDPQLATHARFIDDHLAARPWFAGERLSMADIQMSFPVM
ALLARGGMHDLVHIEAWRQRVEQRPAWQRAIERGGPFTLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacatcatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggagaaaacgatgctggcgccg
gcggcgctgaaaaaaatccatccgttgggcaaatcaccggtactggaagataacggctat
gtgctggcggagtccggggcgatcctcgagtatttgcaggaaacctgggacagcggcggg
ttgttgaagccgcagggaattgacgacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagccttggcaaaccc
cctgtgccctttggcgttcgctcgctgggttcgctgctgggaaaggggatacagaaaacg
tggctcgatccgcagctggccacccatgcgcggttcattgacgaccatcttgccgcacgg
ccatggttcgctggcgagcggctgagcatggccgatatccagatgagcttcccggtgatg
gcattgttggcgcgcggcggcatgcatgaccttgtccatatcgaggcctggcgtcagcga
gtggaacagcgaccggcctggcaacgcgccatcgagcgcggcggccccttcaccttaccc
ggcgcctga

DBGET integrated database retrieval system